I II III IV V
- , , , , , , , -, ...

: ctrl+f

  • : .: 89267904474 - , . 20 . . ( ), . - (-). ICQ 600307272 . ( , , , : , : 50 .), : , .
  • Visser J: .: 113341482, : , , 4421CE, Kapelle, Berkenhof, 6.
  • : : www.ok.ru+ , id : 73099895,
  • - : 11.02.1948 .., - - - .., : , - - , ( : , - - ).
  • : 11.05.1965 .., : , , 1.
  • Qwrwqr Werwrwq: : www.ok.ru+Qwrwqr Werwrwq, id : 73470413,
  • : 24.11.1928 .., : , ,
  • : 13.04.1962 .., : 140 31
  • : Ilford Imaging UK Ltd: : Head Office, : 1898 ., : GB WA16 7JL Town Lane, Mobberley Knutsford, Town Lane, Mobberley GB WA16 7J Knutsford United Kingdom, : D. Jones - Managing Director, : 441565872734, http://www.ilford.com, : Manufacturers, Distributors : 750.
  • : 02.10.1981 .., , . . 69, . (495) 4740492.
  • : TOYOTA SPRINTER, (), , , , 04225, 1991 .., : , :
  • ˲ : : 787105273, 20.07.1921 .., ˲ - .., : , ˲
  • : 23.09.81 ..,
  • : : www.ok.ru+ , id : 27787599,
  • : 1.1.1992 .., - - .., .: 0444 620***, : www.vk.com/id146800171.
  • : 30.12.1994 .., - .., : www.ok.ru+ , id : 27954822,
  • : 1915 .., - . - - ..
  • ..: : , 11, .: 8 (3452) 323035.
  • ? : : www.vk.com/id146490079.
  • : 06.05.1955 .., : 443000, , ., : 81021, , , 0611 *, 08075, 08075, 1985 ..
  • : : www.ok.ru+ , id : 73833976,
  • : : www.vk.com/id220939318.
  • : : ., .: , : www.ok.ru+ , : 2., id : 73342230,
  • ? ?: 11.11.1985 .., , , , , , ³, , , , , , , , , г, , -, - .., .: -, : -, : www.vk.com/id220107405.
  • : 11.3.1993 .., - .., .: 8952-366-17-07, : www.ok.ru+ , id : 27909651, : https://vk.com/verbina_anna.
  • Dasdasd Asdas: : www.ok.ru+Dasdasd Asdas, id : 73570772,
  • "" ( ""): .: 06.02.2003 ., : 3526008343, : 1033501000818, : 352601001, : 19410000000, : , : 162390, , -, , -, 271.
  • : 8.8.1999 .., - .., : www.vk.com/id221010226.
  • : .: 80573389922, +380984806532, : , ?, 48, I
  • : 25.12.1964 .., : , 18
  • : 11.04.1931 .., : , .
  • : 21.12.1979 .., : , . .17 .1
  • Kyrmangalieva Aigerim: : www.vk.com/id220785489.
  • : : Anastasiya_212@mail.ru
  • : : www.ok.ru+ , id : 73531470,
  • : : www.vk.com/id146738746.
  • . .. . -1: : , 10 , 180, : 5299-30-32, 08_ ..
  • : 13.02.1974 .., : , . 17, .: (495) 4430208
  • : 25.01.1988 .., : , - , , 309.
  • : .: 89851435175 - - Jetem C3. . - . - Jetem . . -. , . - . ( , - Jetem C3 Africa, , : , : 2500 .), : , .
  • : 26.7 .., : www.ok.ru+ , id : 73517181,
  • IJ ˲ в: 29.12.1962 .., : , - 5640700000, - I, 10, : VOLKSWAGEN, PASSAT 1.6, 2115, 1989 .., : WVWZZZ31ZKE326925.
  • в: : 3430401951, 02.12.1993 .., - .., : ,
  • : : www.vk.com/id220975213.
  • Geenacker Th K: .: 263214455, : , , 6842CJ, Arnhem, Tarwestraat, 6.
  • : : www.vk.com/id220878697.
  • : : www.ok.ru+ , id : 73115443,
  • : 21.02.1979 .., : , , , 53.
  • : 06.08.1981 .., : LADA KALINA 111830, , 606152, XTA11183080170026, 2008 .., : , . 3
  • : 7.7.1994 .., : , , - .., : Vita3408-3, : www.ok.ru+ , id : 27785160,
  • : 26.11 .., : www.ok.ru+ , id : 73713849, : http://vkontakte.ru/id73713849.
  • : : www.vk.com/id221196297.
  • Sakr Elie: : www.vk.com/id220338559.
  • : 7.11 .., : , : , - .., : , , , .: 89172355619, : , : www.ok.ru+ , : , : maksim, id : 73666950, : , , , : .
  • : : www.ok.ru+ , id : 73601524,
  • : : www.ok.ru+ , id : 73802737,
  • : : 3060621014, 18.10.1983 .., - .., : ,
  • : . , . .26 .4
  • Ѳ : 01.03.1944 .., : , - 5941000000, , 16, : , 2107, 55740, 1995 .., : XTA210700T0952863.
  • : .: 8 9065489450, : . . -
  • : 13.12.1968 .., :
  • : 21.06.1915 .., : , , .
  • [[ : 01.01.1916 .., : (.: 16.05.80 . H) 23, .
  • Gulgena Rishatovna: : , : grishatovna@mail.ru
  • : 05.12.1939 .., : , , 50 , 52.
  • : : www.ok.ru+ , id : 73658026,
  • Popescu Eugen: : www.vk.com/id220513156.
  • : : , : , : , : , : www.ok.ru+ , : , : , id : 73290420, : ,
  • : 30.9 .., : www.vk.com/id219990370.
  • VOLKOVA IRINA: : --> HRG, : - .
  • : 22.09.1931 .., , . . 1/17, . (495) 2792977.
  • : 11.02.1940 .., , . . 18 . . 18, . (495) 9470028.
  • : 06.09.1974 .., : ., , , .3
  • : .: 8 (8312) 432379, : . , , 7
  • : 15.02.1960 .., , . . 6, . (495) 2767372.
  • : 14.3.1990 .., : www.ok.ru+ , id : 73174677,
  • : 16.06.1957 .., : . -, -, ., 3, .: (812) 3870054.
  • : 30.04.1974 .., : (.: HH . H) 36, .
  • : : , . .79
  • : 21.07.1981 .., : , , , 101
  • : 19.01.1969 .., . - ..
  • : 14.4 .., - .., : www.ok.ru+ , id : 73150042,
  • ..: : ., , ., 45, .: 8 (8184) 30171.
  • -: .: 0908759, : , , -. 4, .50
  • : 16.12.1923 .., , . . 1 . 3, . (495) 1918362.
  • : : , . . . 48/9, . (495) 4655861.
  • : 31.10.1983 .., :
  • Landar Benoit: : www.ok.ru+Landar Benoit, id : 73549457,
  • : 1.2.1994 .., : www.vk.com/id220373391.
  • : 15.09.1970 .., : ., . -, 7
  • Alatrash Walaa: 1.1.1989 .., : www.vk.com/id220618586.
  • : 1957 .., : ., , , , 21
  • : : www.vk.com/id146470659.
  • : : www.vk.com/id146607627.
  • : .: 89035066951 - , , , ( ), , . . ( , - 38 -, , , , : > : 38, : 1000 .), : , .
  • Rafik Agent: : www.ok.ru+Rafik Agent, id : 73254185,
  • : 24.12.1981 .., : , .144
  • : 15.07.2004 .., : ,
  • : : www.ok.ru+ , id : 73257870,
  • : 21.10.1928 .., : , , , , , 11
  • : .: 89637647358 - ABS, , , , , , , . , , , . (, Ford Transit, 2006, , Ford Transit, 2006 . 160 000 - 169 999 , 2.4 , , , , : 650000 .), : , .
  • : 05.04.1961 .., : , ., , , 73, : 091601 2002 ..
  • : 04.04.1979 .., , . . 34 . 2, . (495) 2836384.
  • : 28.07.1975 .., : . 34. : "".
  • : 13.6.1980 .., - .., .: 067-290-19, : www.vk.com/id146745160.
  • : 01.01.1900 .., : , - 5920650100, ., 73/7, : , 11, 5318, 1989 .., : 0, 494920.
  • : .: 8 (921) 6312869, 2941453
  • Halim Halim: : www.vk.com/id220682818.
  • : : www.vk.com/id146567412.
  • : 18.11.1987 - .., --, - .., : , --, , 3
  • : : www.ok.ru+ , id : 73441062, : http://vkontakte.ru.
  • Ghrgdr@ua.fm Ghrgdr@ua.fm: .: sdfds, : www.ok.ru+Ghrgdr@ua.fm Ghrgdr@ua.fm, id : 73613142, : fdsf.
  • : 16.02.1978 .., : , , , 7 : "" ..
  • : 15.09.1937 .., : , , 2 2 10
  • : 04.01.1942 .., : , , , 13
  • : 19.11.2004 .., : , .4 .1
  • Ѳ: : 2473418178, 20.09.1967 .., Ͳ - .., : , Ͳ
  • : 17.11 .., : www.vk.com/id220377314.
  • : 23.11.1961 .., : , . .24 .1
  • : 29.09.1935 .., : ., . -, 13
  • : 18.11.1966 .., : ., , . , . ., .2
  • : : , 41, .: 8 (831) 669400
  • ( ) : : , : , - .., : !, .: , : , : www.ok.ru+( ) , : ICarly.com, : , id : 73406665, : ,
  • : : www.vk.com/id220379251.
  • : 24.12.1974 .., - .., : www.vk.com/id220371194.
  • : 29.09.1951 .., : , . . 27, .: (495) 3126672
  • : 12.02.1949 .., : ., : , .
  • : 20.11.1993 .., : - , ., . , 13
  • : 14.09.1991 .., : , , , 3
  • : 27.11.1999 .., : www.vk.com/id220089167.
  • : 28.06.1946 .., : , - ., ., 93. : " "
  • : 28.02.1975 .., : ., . -, 7
  • : : www.vk.com/id221073588.
  • : 21.4.1982 .., : www.vk.com/id146549886.
  • : 17.07.1962 .., : ., 88 .: 555417
  • MIN EDUC SUP NIVEL CTRAL: .: FR186513, : , 23 # 565 VEDADO
  • : 04.01.1951 .., :
  • : 17.10.1938 .., : , .
  • Ѳ в ò: : 3183911818, 04.03.1987 .., - .., : ,
  • NANTONG City Education International Intercourse Service Center: : CHEN,YUNBO, : undertake education system foreign affairs , mix volitant business, : , 226001, Jiangsu, Nantong, No. 1, JIANSHE Road, .: (513) 5118393.
  • : : www.ok.ru+ , id : 3289135,
  • : 1.12.1966 .., : www.vk.com/id220103151.
  • : 6.12 .., : www.ok.ru+ , id : 3065637,
  • () : : www.ok.ru+() , id : 27935555,
  • : 2.6 .., .: 8-920-591-66-74, : terra887, : www.vk.com/id146923896.
  • : . , . .18 .2
  • : 25.8.1989 .., : www.ok.ru+ , id : 27862402,
  • : 4.1.1996 .., : ., .: 8-916-692-84-28 (), : michelsminne, : www.vk.com/id220301210.
  • : : www.ok.ru+ , id : 73091404,
  • : .: 8-921-5479076 (), 88202651733, : ., .., .-, . ., 26
  • : : www.vk.com/id221012754.
  • : : , . .17
  • : 07.05.1956 .., : . -, -, ., 11, .: (812) 3118387.
  • : .: 0652222169, 0652296767, +380505773552, : , . , . 100
  • Verkoophal-Harmelen: : -, 3481MC, Harmelen, Energieweg, 11, .: 348441996.
  • "" ( ""): .: 11.12.2011 ., : 3702071390, : 1053701074690, : 370201001, : 24401000000, : .2 .21.1 08.08.2001 129-, : 153038, , , -, 4.
  • : : www.ok.ru+ , id : 73223488,
  • : . .: 8 9056298618, : . . 12
  • : 28011961 .., : ., .18, : 217030, 69164, 2008 .., : XTA21703080114817.
  • : Tie Rack, 5142, Shops & other Retail Outlets, Ties & Neckwear, : , , Ground Floor/Bentalls Shopping Centre, Wood Street, Kingston upon Thames, Surrey, South East, KT1 1TR, KT1 1TR, South East, Surrey, Kingston upon Thames, .: 442089748184, www.tie-rack.com, : Miss Sarah Russell (Branch Manager)
  • : 10.07.1961 .., : , , , 4
  • : 1962 .., : 58. :
  • : : www.vk.com/id220645328.
  • : 10.2 .., - .., : www.vk.com/id220143521.
  • : : www.ok.ru+ , id : 73263587,
  • : : www.vk.com/id220378264.
  • I: .: 80976760396, +380965217115, : , . 3,
  • : : www.ok.ru+ , id : 27907286,
  • : .: 89165896143 - , Kapraun-Ledermoden (). 52. , . . .. - , . .. 60000, , , . ( - 187). ( , kapraun .50-52, , , , : > : 5052 (XL), : 25000 .), : , .
  • : TOYOTA LAND CRUISER, (), , , , 258851, 1995 .., : , :
  • : 23.6.1998 .., - .., : www.ok.ru+ , id : 73541061,
  • : TOYOTA CAMRY, (), , 14, 14, 254434, 1992 .., : , :
  • : :
  • Djaiez Mohamed-Momo: : www.vk.com/id221151840.
  • Delgado Renato: Recife - .., : www.vk.com/id220982537.
  • WUXI City Suburb XUXIANG Shu Newspaper booth: : YANG,A'E, : books and newspaper, : , 214063, Jiangsu, Wuxi, No. 82-5, LIXI Road, .: (510) 6764804.
  • : : www.ok.ru+ , id : 73709245,
  • : 24.10.1923 .., : , , , 14.
  • : 1.9.1999 .., - .., : www.vk.com/id220703854.
  • : 17.3.1989 .., - .., : www.vk.com/id220490471.
  • : : www.vk.com/id221123084.
  • : : 2155235410, 03.01.1959 .., - .., : ,
  • BAOYING County XI'ANFENG Town Electric power pipe LI Station: : LIU,HUAIBANG, : in charge of electric power plan . construct . administrate and country enterprises & organizations unit electrics professional work training and examine, : , 225800, Jiangsu, Yangzhou, No. 9, JIAOTONG Road, XI'ANFENG Town, .: (514) 8661010.
  • : : 3082422214, 23.05.1984 .., ' - .., : , в
  • : 11.3.1995 .., . - .., : www.vk.com/id146757059.
  • : 07.12.1962 .., : , ., .12,
  • : 11051951 .., - .., : . . .44 .1
  • : 1.10.1998 .., : www.vk.com/id220252643.
  • : 11.06.1924 .., : , , 4- , 13
  • : 20.12.1951 .., : ., . 26
  • Mustafa Nuh: 9.4 .., : www.vk.com/id220839352.
  • : 12.5 .., : , : www.ok.ru+ , id : 73320034, : http://vk.com/id73320034.
  • Rojas Bruzon Elizabeth: .: 425066, : , N.lopez No. 283 e Peralejo y Coliso
  • : : www.ok.ru+ , id : 73362437,
  • FUN FASHION EMIRATES (L.L.C) : : -, (), 117965, Dubai, : 97143513444, : Imitation Jewellery Trading
  • Made-In-China Petruheo: : www.vk.com/id220209853.
  • : 01.08.1954 .., : (.: 11.12.91 . H) 32, .
  • Ѳ : : 3155814374, 27.05.1986 .., - .., : ,
  • Ali Ayshe: : ime_291323, : www.ok.ru+Ali Ayshe, id : 73713324,
  • : 21.10 .., : www.vk.com/id220070582.
  • : : www.vk.com/id220540596.
  • : 17.09.1961 .., : , . .8
  • : 20.03.1966 .., : , , (--39).
  • 02.07.1965 ..: : ., . .52
  • : : , . 30
  • Dasbdas Asbdsadsa: : www.ok.ru+Dasbdas Asbdsadsa, id : 73781131,
  • : 19.8.1989 .., : happiness, : www.ok.ru+ , id : 3129459,
  • : 09.10.1928 .., : , , /., , , 5
  • : 07.10.1965 .., : , , ., -, ., 70 ., 42, : 11183, 73863 *, 11183060023003, 0023003, 1471823, 2006 ..
  • : Aug. Sdders Maskinfabrik ApS: : Head Office, : 1876 ., : DK 2610 Hjnsvej 52 Rdovre, Hjnsvej 52 DK 2610 Rdovre Denmark, : Bjarne Garlin Pedersen - Commercial Management, : 4536706570, aug@saedder.dk, http://www.saedder.dk, : Manufacturers : 6 : 162799 EUR : 125000 (DKK) : Danske Bank.
  • : 5.1.1984 .., : www.ok.ru+ , id : 73486322,
  • : 16.11.1991 .., .: 8........, : www.ok.ru+ , id : 73746421,
  • A: : ., 3110 ( ) , - -, 1999 .., : , : 88840, 70697, 40620F-Y4000858, 795558, X0214928, XTH311000X0214928, :
  • : : www.vk.com/id220116704.
  • ZHENJIANG City Power electrical appliance Safe Institute: : power electrical appliance installation development , technology transfer , technical consultation , technical service, : , 212003, Jiangsu, Zhenjiang, DINGMAOQIAO, .: (511) 421863.
  • Ѳ ò : : 3079022899, 19.04.1984 .., . - .., : , .
  • : 27.05.1950 .., : ., , , .15
  • : 14.11.1952 .., : . -, -, ., 4, .: (812) 5584820.
  • : : www.vk.com/id220061419.
  • Dada Dada: : www.ok.ru+Dada Dada, id : 73575541,
  • : 12.12.1990 .., - .., : www.vk.com/id146732258.
  • : 10.02.1970 .., : 443093, , , , , 58, : 21104, , , 624163, 21104050852234, 0852234, 1291862, 2005 ..
  • 05.04.1921 ..: : ., . .117
  • : : 1649812693, 03.03.1945 .., в - .., : , в
  • Entourageefina Julie: 18.7 .., : www.ok.ru+Entourageefina Julie, id : 3294010, : -.
  • : 12.01.1982 .., : , ., 52, .: 8 (3812) 403874, : ZD R, 98155*, 99_ ..
  • Leinonen Denis: 16.10 .., : www.ok.ru+Leinonen Denis, id : 3214398, : http://ru.dancingsantacard.com/?santa=8110593.
  • : 29.8.1983 .., : www.vk.com/id221097694.
  • : 21.06.1956 .., : . 5
  • : 08.02.1978 .., : ., --, , 24/5.
  • Gerdt Schenja: Omsk - .., : www.ok.ru+Gerdt Schenja, id : 73628054,
  • : 16.06.1949 .., : ., ., , .72
  • Demeter Bela: - TERRA-VITA Kornyezetgazdalkodasi Kft., 1978 ., : 3300, Eger, Gronay ut 10., TERRA-VITA Kornyezetgazdalkodasi Kft., : teeravita@mail.matav.hu, http://www.terravita.hu, tel.: +36 (36) 51 91 33; fax: +36 (36) 31 12 52;, (36) 31 12 52, : Tevekenyseg: Kornyezeti karfelmeres; karelharitasi tervek keszitese; szennyezett talaj- es talajviztisztitas; veszelyes hulladekok szallitasa, artalmatlanitasa; folyekony telepulesi hulladekok, husipari folyekony, iszapszeru hulladekok kezelese; TERRA-VITA humusztragya-, viragfold gyartasa, ertekesitese; boraszati kekalj artalmatlanitasa, , , , , , , , , , , , , , , , , , (), .
  • : 17.05.1988 .., : 650001, . , ., . .6
  • : 10.11.1970 .., - .., : www.vk.com/id220706402.
  • : 09.06.1994 .., : , . .3 .2
  • : Klubferband-ITA OOD: : 1992 ., : Bolgariya, 1309 Sofiya, ul. Kukush 1 IST, Bolgariya, 1309 Sofiya, ul. Kukush 1 IST, : Borislav Todorov Pavlov - , : 35929200881, kvita@intech.bg, : , , ( ) : 5 : 2.701 USD.
  • Sarmiento Kaariitoo: 26.12.1995 .., : www.vk.com/id220249822.
  • : 6.5.1969 .., : www.vk.com/id220987144.
  • : 26.11.1905 .., : , . .11
  • : 04.01.1993 .., : , . .42 .1
  • : 02.01.1929 .., : ., , , .4
  • : 13.02.1954 .., , 2- . . 12, . (495) 1613868.
  • : 12.06.1968 .., , . . 1/12, . (495) 4252186.
  • : : www.vk.com/id221098857.
  • Amalia Maikee: 11.6 .., : www.vk.com/id220393115.
  • : 01.02.69 .., : , , ., 23. : " ", 454007, - , 3
  • : 25.06.1959 .., : , : ., .3
  • : : , , 25.01.2002 .. .3
  • : , . . 17/19 ,
  • : : www.vk.com/id220409894.
  • : : www.vk.com/id220607686.
  • : : www.ok.ru+ , id : 73283801,
  • : : . .: 431244.
  • : 01.06.1935 .., : , , ().
  • : : www.vk.com/id220197186.
  • : : www.vk.com/id219991776.
  • : 1972 .., : , , .
  • : 30.1.1999 .., : www.vk.com/id146553760.
  • : 01.01.1976 .., : , . .11 .1
  • : : , . . . 11 . 1, . (495) 9121240.
  • Jack Rose: : www.vk.com/id220805805.
  • : 05.05.1966 ..
  • : 10.12.1977 .., : .111
  • : 10.05.1942 .., : , . .40
  • "" ( ""): .: 01.07.2013 ., : 6321202578, : 1076320034801, : 632101001, : .2 .21.1 08.08.2001 129-, : 190005, - , -, 216.
  • : 19.08.1923 .., : , , ,
  • Jhjjj 777: : www.ok.ru+Jhjjj 777, id : 73637872,
  • Cloud Curly: : www.vk.com/id221111599.
  • : 16.10.1927 .., , . . 6 . 2, . (495) 4673224.
  • Maxmud.ismoilov: : www.ok.ru+ Maxmud.ismoilov, id : 73376529,
  • : 01.05.1979 .., : , .
  • ²˲ ò: : 3101616393, 01.12.1984 .., Ͳ- - .., : , Ҳ
  • : 14101962 .., - .., : - . . .15.
  • : .: 89265887083 - . ( , , , : ), : , .
  • : 29.7.1992 .., - .., : www.vk.com/id220038397.
  • : 18.05.1967 .., .: 8 9042836170 - , : ., 675000
  • : 15.01.1943 .., : , , , 16.
  • ˲ : 02.10.1967 .., : , - 5925050100, ʲ, 16, : , 53, 00604, 1977 .., : 0.
  • : 11.07.1974 .., : , --, -, ., 19. : , : , .--, : , .: 54-13-16.
  • : : www.ok.ru+ , id : 73755821,
  • : 02.09.1929 .., , . . 18, . (495) 9366139.
  • : 05.11.1989 .., : , . .59
  • : 8.3 .., - .., : www.vk.com/id221105642.
  • : , . . 51 . 2 ,
  • : : --> , : - .
  • : 23.11.1946 .., : , . .38 .2
  • : 27.12.1950 .., . , . .3 .2
  • : 12.12.1954 .., : , , 150
  • Hf Gg: : www.ok.ru+Hf Gg, id : 3192785,
  • : 10.4.1997 .., : www.ok.ru+ , : sasha_makarenko, id : 27766541,
  • : 30.8.1975 .., - .., : www.vk.com/id146754349.
  • : 22.03.1971 .., : , : ., -: , ., 2- , 31
  • : 18.06.1918 .., : , , .
  • : : www.ok.ru+ , id : 27801230,
  • : : , . . 11 ,
  • : : www.vk.com/id220864372.
  • : : ., .- - 150 - 68, : 412028, 4166, 1989 .., : 6483123.
  • HUAIYIN City QINGPU District Herding Veterinarian Station: : WU,MINGSHI, : , 223003, Jiangsu, Huaiyin, CHAIMI Village, CHENGNAN Town.
  • : 14.02.1963 ..
  • : 6.7.1978 .., - .., : www.ok.ru+ , id : 3095215,
  • Ҳ ²˲ : : 2619520291, 20.09.1971 .., - .., : , Ѳ
  • , , : 11, 4174, 1987 ..
  • : 23061945 .., : ., . .47, : 2410, 53264, 1986 ..,
  • : 07.05.1937 .., : . / . .
  • : : www.ok.ru+ , id : 27949670,
  • : 14.2.1937 .., : , : www.ok.ru+ , : danildrozdenko, id : 27945718, : http://www.iosifkobzon.ru/.
  • : 30.09.1959 .., : , . --, ., 8. : , : , , 3, : , .: 544021.
  • ? ?: 3.12 .., : www.vk.com/id220425008.
  • : 26.08.1993 .., .: (495) 9177415
  • : 09.08.1976 .., : , , .
  • Schulepow Viktor: : www.vk.com/id146516867.
  • : 15.11.1971 .., : , , , 56
  • : : ., .46 .1
  • : 22.08.1975 .., : ,
  • : 7.5 .., .: 89***********, : www.vk.com/id146919813.
  • Makuov Tamerlan: 5.5.1989 .., : www.vk.com/id220640382.
  • : 29.09.1936 .., : 95022, , , .ѳ, . , 67.
  • : , . . 2 ,
  • : : www.vk.com/id220389101.
  • BAOYING County HUANGCHENG Town Finance Institute: : PAN,ZENGBI, : villages and towns finance budget . financing management . intendance, : , 225807, Jiangsu, Yangzhou, HUANGCHENG Town, .: (514) 661040.
  • : 13.12.1932 .., : ., . -, 29
  • : 30.09.1973 .., : ˨ , : ., .57
  • : : , . . 17, . (495) 4523320.
  • : : www.ok.ru+ , id : 73575599,
  • : : www.ok.ru+ , id : 28047727,
  • : 4.11 .., : www.vk.com/id221087292.
  • ..: , . . 3 ,
  • NANTONG City XINCHANG City Art Advertise Co.,ltd.: : CHEN,JINHUA, : advertise, : , 226006, Jiangsu, Nantong, 2-203#, NANCHUANYUAN.
  • :
  • : 20.10.1993 .., : , , , 13
  • : 26.10.1951 .., : , : ., .5
  • : : www.vk.com/id146595057.
  • : 15.02.1964 .., . - ..
  • : 1.5 .., : www.ok.ru+ , id : 27968383,
  • : : Kalisha , .: +7 *** *** ** **, : www.ok.ru+ , id : 73871886, : http://sprashivai.ru/OlyaKalinina.
  • : 19.12.1953 .., : ., . -, 36
  • : 14.10.1963 .., , . . 1, . (495) 4250766.
  • : 28.12.1985 .., : , 13
  • : . .: 8 9056510267, : . , . , .47
  • : 28.11.77 .., : , , ., 29
  • : : www.vk.com/id146612664.
  • : 4.4.1989 .., : www.ok.ru+ , id : 3122763,
  • : .: 8 9065311645, : . . 7
  • 9617027432 PRE_PAY: .: 8 9617027432
  • Pichuguin Slavi: 12.8.1995 .., : www.vk.com/id219998107.
  • - -: : www.vk.com/id220129071.
  • : , . . 29 ,
  • : 11.12.1974 .., : www.ok.ru+ , id : 3223640, : .
  • : - .., .: 0999098019, : www.vk.com/id146930773.
  • : : , . 3,.3
  • : 20.02.1937 .., : , .
  • : : --> , : - .
  • : - .., .: 8**********, : www.vk.com/id220322748.
  • Gopannagari Shashank: : www.vk.com/id220683052.
  • : 26.10.1974 .., : , , ., -, ., ., 9, : 21061, , 83063 *, 210600S3475334, 3475334, 4130200, 1974 ..
  • Gsv Roman: : www.vk.com/id220688612.
  • : . ... ... - .., : www.vk.com/id221136448.
  • Ͳ ˲: : 3045325533, 18.05.1983 .., .ȯ - .., : , .ȯ
  • : 17.10.1970 .., : 2121, 35702, , 1983 .., : 212100D0319870, 0319870, 6889358, : , , ., 6.
  • : 15.07.1973 - .., : , , , , , 117, : 53212, , M183CHM, -, 1983 ..
  • : ..: 8 9172586549, : , . , 59, . , . , , 423450
  • : : , : www.ok.ru+ , id : 3216852,
  • Esser M P E: .: 455715454, : , , 6411DV, Heerlen, De Heugden, 250.
  • : 27.05.1935 .., : ., . -, 10
  • : .: 89601313145 (), : ., 396420, . , . , .4
  • : : www.vk.com/id220099044.
  • : 9.11 .., ( ) - .., : www.vk.com/id221010694.
  • : : www.ok.ru+ , id : 73609800,
  • : : www.ok.ru+ , id : 27763836,
  • : 16.1.1994 .., : www.vk.com/id220435621.
  • : : www.ok.ru+ , id : 27947052,
  • : : www.ok.ru+ , id : 73841572,
  • : 01.01.1900 .., : , - 5920688901, 0, : , 4, 5014, 1988 .., : 086366.
  • : ϲȪ "" ( ""), : , 83007 , , . , .1, .203, .: , 83007 , , . , .1, .203, .: ̲ ί ̲ί , 0080264, 16.07.2002 ., : 1) 2914812024, , : : 71130 ò Ͳֲ, в ί ֲ : , ..: 938735.
  • : : www.ok.ru+ , id : 73422154,
  • Katrin Katrin: : www.vk.com/id220478235.
  • : .: 8 9025334065, : , , 8
  • ² : 11.11.1911 .., : , - 5623450100, 17, 17, : FIAT, REGATA, 2600, 1989 .., : 07364915.
  • Iv : : www.ok.ru+Iv , id : 73233554,
  • : - .., .: , : , : www.vk.com/id146636898.
  • : 29.11 .., : www.vk.com/id221179755.
  • Fahmi Nina: 1.1 .., - .., : www.vk.com/id220342787.
  • : : www.vk.com/id220385459.
  • : : , . 13
  • : 27.2 .., : www.vk.com/id220393559.
  • : 01.02.1970 .., : , . ., .23,
  • : : 838303332, 14.12.1922 .., ²' - .., : , ²'
  • : . .: 8 9065376798, : . . 49/1
  • Rfgrrfrfr Nbhf: : www.ok.ru+Rfgrrfrfr Nbhf, id : 73731428,
  • : 22.04.1951 .., : , ., 44.
  • ˲: : 3069620511, 16.01.1984 .., - .., : ,
  • : 16.06.1957 .., : ., , , .11
  • : 3.1 .., : ?, - .., : www.ok.ru+ , id : 3139682,
  • : .: +79102651541, : www.vk.com/id220378302.
  • : : . , , 5, .: 8 (3472) 348555.
  • Lianyungang CANGWU Park: : CHENG,XIANGGEN, : entertainment * enrollment what is capitalized on :$2998.00 dollar, : , 222001, Jiangsu, Lianyungang, CANGWU Road, .: (518) 5805477.
  • Inaccessible Temporally: : www.ok.ru+Inaccessible Temporally, id : 73862018,
  • : 05.09.1940 .., : , 408, , ., 15
  • : : www.ok.ru+ , id : 73150965,
  • : 07.05.1964 - .., : , 2102, , 03156, 1976 .., : .15 .0
  • : 11.06.1973 .., : , ., . , 134
  • : 27.1 .., : www.vk.com/id220456500.
  • : : www.vk.com/id221162840.
  • JIANGSU Province XIANGSHUI County Psychosis Control Institute: : WANG,JIWU, : , 224611, Jiangsu, Yancheng, East Side, TONGYU Road, XIAOJIAN Town, .: (515) 211357.
  • : 1966 .., - . - - .., .: ()
  • : 16.10.1934 .., . , . .90
  • ..: : , . . 19 . 2 ,
  • : : www.vk.com/id220465365.
  • : 12.06.1977 .., : ., . -, 7
  • : 29011982 .., - .., : - ..
  • : 17.7.1987 .., : www.ok.ru+ , id : 27709098,
  • : .: 89069327775 (), : . . 14
  • : : 3166812756, 14.09.1986 .., - .., : ,
  • : : , : www.ok.ru+ , : , : metallica, bon jovi, , queen, nazareth, van halen , id : 27856919,
  • : : www.ok.ru+ , id : 73862564,
  • ? ?: : www.vk.com/id220508663.
  • : : www.ok.ru+ , id : 73325590,
  • : 10.06.1938 .., : ., , , .9
  • Fg Gf: : www.ok.ru+Fg Gf, id : 73096579,
  • : 23.04.1952 .., : , -
  • : 1.8.1980 .., : www.vk.com/id220514140.
  • : : www.ok.ru+ , id : 73860166,
  • : 15.11.1915 .., : ., . -, 8
  • Ivanova Irina: : www.vk.com/id220840880.
  • : 17.11.1970 .., : , . . 10, .: (495) 9766377
  • : 6.4 .., - .., : www.vk.com/id220207052.
  • : 1929 .., : , , .
  • 5070009951 1045000005599: ./: 0, 0, : , , ,
  • Owusu Emmanuel: : www.vk.com/id221181302.
  • : 12.4.1992 .., : ! ... ! , , ... - .., : , , TIFFANY ??, : www.ok.ru+ , : 2, : =), id : 73363402, : , -, , , , , , , , .... =),
  • ORDANIA CABRERA HERNANDEZ: : CUBANA, : , , EDIFICIO 5 APTO13 OLIVOS 1; ..: 368010100090185, : EDIFICIO 5 APTO13OLIVOS 1
  • "" ): .: 19.03.2007 ., : 7813914187, : 1077847160115, : 781301050, : .2 .21.1 08.08.2001 129-, : 190000, - , -, 26/28.
  • Integrated circuit * earl eye: : , 812-0013, Kyushu/Fukuoka, www: icri.com/, icri.com/, info@icri.com, .: 092-474-0440, 81924740440, : Business and Economy/Business to Business/Internet Services/Consulting/
  • : : www.vk.com/id220121462.
  • : 23.02.1961 .., : , , .( -).
  • Ogerrob Xela: 5.2.1994 .., Pico Rivera - .., : www.vk.com/id220382449.
  • : 11.7.1991 .., - .., .: , : , : www.vk.com/id146882405.
  • : 12.12.1958 .., : , . , ., 5. : " ", : , 680001 . . 87, : , .: 53-79-29.
  • 9056473970 PRE_PAY: . .: 8 9056473970,
  • : .: , : www.ok.ru+ , id : 73695511,
  • : - "". : , 53. : 1000 .
  • : Anchor, 6720, Head Office, Insurance Services, : , , 50 Kinmel Street, Rhyl, Clwyd, Wales, LL18 1AW, LL18 1AW, Wales, Clwyd, Rhyl, .: 441745339009, : Mr Gareth Morris (Proprietor)
  • : 7.1.1987 .., - .., : www.vk.com/id220413727.
  • : 22.05.1951 .., : ., .- , .: 8 (812) 2748798, : 21093, 57978, 1999 .., : 2109302540151, 2637194.
  • : 04.02.86 .., : , , -., .
  • : : www.ok.ru+ , id : 27831080,
  • D Nebo: : www.vk.com/id146672585.
  • Pleasure Dancefor: : www.ok.ru+Pleasure Dancefor, id : 27983347,
  • : 09.09.1964 .., : . -, -, ., 49, .: (812) 3795486.
  • : - .., : www.ok.ru+ , id : 73163192,
  • : 15.07.1912 .., , . . 4 . 3, . (495) 1341656.
  • : 21.04.1984 .., : ., . -, 23
  • : 2.5.1999 .., .: 89161785554, : www.ok.ru+ , id : 73200221, : .
  • IJ ò: : 1743214438, 23.09.1947 .., ò - .., : , ò
  • ²в: 14.08.1956 .., : , - 5640100000, , 2, : MERCEDES-BENZ, 200 D, 57219, 1981 .., : 12312010235657.
  • . .: : ., , , 328, .: 8 (4862) 722306.
  • : 01.10.1936 .., : ., . . .102
  • : 01.06.1964 .., :
  • Laev John: 10.3.1993 .., SAMNEW - .., : www.vk.com/id220109342.
  • : : www.ok.ru+ , id : 73730350,
  • : 18.01.1980 .., : 443051, , , , , 49/101, : , , -, 11163 *, 11U532665628, 532665628, L920126, 2002 ..
  • Jacob Rollando: : www.ok.ru+Jacob Rollando, id : 73289195,
  • : : www.ok.ru+ , id : 27856217,
  • : .: 89609144277 (), : . . 3 80
  • : .: 8 9089658564, : , , . , 36
  • : 8.2 .., : www.ok.ru+ , id : 3296763,
  • ̳: : www.vk.com/id220747873.
  • : 22.03.1989 .., : , .
  • : 15.9 .., : www.ok.ru+ , id : 73115252,
  • : 1.4.1996 .., : -, ., : =))), - .., : , , ..., : , , , ..., : www.ok.ru+ , : , , , , .., : , Mylene Farmer, Lionel Richie, The Beatles, Queen, Johnny Cash, . , ..., id : 3221689, : ,))), ., ... , .=),
  • : 29.5.1994 .., : www.ok.ru+ , id : 73339461,
  • : 28.9.1984 .., : www.vk.com/id221167599.
  • : : www.vk.com/id220884172.
  • : 10.08.1981 .., , . . 7 . 3, . (495) 3814118.
  • : .: 89050494624 (), : ., . . 50
  • : , . . 26 . 3, . (495) 7580575.
  • : : www.vk.com/id146808316.
  • : : , , 27.01.1985 .. .4
  • : 11.02.1969 .., : , .49
  • : .: 8 (812) 457385, .: 7250360 (Tele2), : , , . 6 5
  • : 8.3.1982 .., - .., .: , : www.ok.ru+ , : , id : 73603887,
  • : : www.ok.ru+ , id : 73337072,
  • : 22.04.1965 .., : , , , 160. : " ""
  • : 22.07.1986 .., : , 368668,-
  • ..: , . . 14 ,
  • : 16.11.1990 .., : me &, you would never work out as a couple, we',re too much of good mates...i',d fuck you though - george, : malibu, - .., : www.ok.ru+ , id : 3144825, : , , , HMV, , malibu, grunge music, , , myspace, H&,M, , , party @ asa',s, hell no, , , , , !, , , , , HMV, liqiud, maids, , , heathrow, thames trains, mix, primark, . , _, , snake bites, cogito, trafalgar square, , , media studies, , , , , ,
  • : : , .: 89278998254, : www.ok.ru+ , id : 73800386, : , : www.danil83.myffi.biz.
  • : ²²Ͳ "IJ" ( "IJ"), : , 91033 , , . , .145 , .: , 91033 , , . , .145 , .: ̲ ί ̲ί , 13821050001011568, 15.04.1997 ., : 1) 2411702034, в ˲, : : 99999 , : 45.21.1 i i, ..: 338873 ..: 338873.
  • ò: : 3036423178, 18.02.1983 .., - .., : ,
  • : : 2772719875, 30.11.1975 .., - .., : ,
  • : 27.11.1948 .., : , , 92
  • : 01.01.1969 .., , . . . 48/9, . (495) 4651288.
  • : 26.09.1941 .., , . . 18, . (495) 4006692.
  • : 4.12.1986 .., .: 89513634425, : www.vk.com/id220400426.
  • Idiot Moron: : www.ok.ru+Idiot Moron, id : 73407383,
  • : : www.vk.com/id220385589.
  • : : www.ok.ru+ , id : 73859301,
  • : 23.04.1996 .., : , - , , 7.
  • : 13.05.1922 .., : , , , 11
  • Reyes Valdes Ram=n: .: 813349, : , 51 final #4407 i, , e y ,,C. delsur
  • : .: 9112181910, 8 (812) 1120777, : , -, ., .21, .4
  • : 19.12.1985 .., : , , , 114. : 15 //, : 160555 . , 8 .
  • : 07.05.1939 .., : , .
  • Sadvakasov Ilyas: : www.ok.ru+Sadvakasov Ilyas, id : 73335204,
  • Laurenco-Da-Silva Marcelo: : www.vk.com/id220469202.
  • " ": 80 .., : ., .47, : 93700, 211564, 1988 ..,
  • : : , 13- . .15
  • : 1928 .., . - ..
  • : 03.10.1923 .., : , , .
  • : 25.06.1930 .., : , , .
  • Karinka Mohonko: : , : KarishaMohonko@mail.ru
  • : 29.7 .., : www.ok.ru+ , id : 73832954,
  • Ѳ : : 3024922151, 26.10.1982 .., .ȯ - .., : , .ȯ
  • : : , . 26
  • Ѳ: : 3139614377, 16.12.1985 .., .ȯ - .., : , .ȯ
  • : 23.11.1971 .., : 74 35
  • : 14.1 .., - .., .: 925 03, : www.vk.com/id146599526.
  • : : www.vk.com/id146653227.
  • Erer Rere: : www.ok.ru+Erer Rere, id : 73137272,
  • : : www.vk.com/id221156699.
  • : : 1051519993, 15.10.1928 .., - .., : ,
  • Faizov Vitalii: : www.ok.ru+Faizov Vitalii, id : 73799362,
  • : 27.9 .., - .., : www.vk.com/id220800604.
  • : : www.ok.ru+ , id : 3177950,
  • : . , . . .6 .3
  • : : , . 9,.1
  • : 21.04.1948 .., : ., . -, 6
  • : : 6602, 5485, , 1984 .., : 0396363, 0257612, : , ..
  • : 15.03.1960 .., : , 424, , , 30. : , : , 17, .: 48505
  • : 10.07.1960 .., . - - .., .: ()
  • : 22.04.1945 .., : , . . . 12, .: (495) 1521429
  • Maximmal Maximmal: : www.ok.ru+Maximmal Maximmal, id : 3184280,
  • Oifne Renoin: : www.ok.ru+Oifne Renoin, id : 73297084,
  • : 03.02.1928 .., . , . 3-274
  • XISHAN City YANFENG Materials Co.,ltd.: : WU,MINGSHI, : , Jiangsu, Wuxi, YANQIAO Town.
  • : 23.11.1986 .., : www.vk.com/id221110769.
  • : 11.02.1949 .., : , . . 3, .: (495) 3611536
  • : 25.07.1967 .., : ., . 17 08.2004 .., . , .3 .2
  • ³: 08.12.1977 .., : 95492, , , .ѳ, , ., 10.
  • : 06.05.2003 .., : , .75 .3
  • Nikolaev Alex: : www.vk.com/id221168757.
  • : 10.09.1938 .., : , - ., ., 1
  • Huitch Bill: : www.ok.ru+Huitch Bill, id : 73266985,
  • : 9.6 .., : www.vk.com/id220577667.
  • : 6.6 .., - .., .: 89532140657, : www.vk.com/id220800526.
  • ij: 6.5 .., : ....., : www.ok.ru+ ij, id : 73400004, : ask.fm/Blond007d http://instagram.com/dianamedunska.
  • : : www.vk.com/id220050756.
  • : . .: 8 9059039747, : . . 1
  • : : 2387621651, 15.05.1965 .., - .., : ,
  • ֲ ò : : 3052225332, 26.07.1983 .., ֲ - .., : , ֲ
  • : 10.06.1979 .., , - .., : 25/10
  • : 10.5 .., .: 89128503669, : www.vk.com/id146923811.
  • Dasda Asdas: : www.ok.ru+Dasda Asdas, id : 73756252,
  • : .: 89258740431 - ! ( , Epson Stylus SX130, , : , : 1500 .), : , .
  • : 07.10.1995 .., : , . .23
  • : 31.01.1997 .., : , . .50
  • : : www.ok.ru+ , id : 28049810,
  • : 03.03.1971 .., : , , , 57.
  • Abdelmassih Fadi: 9.11.1991 .., : www.vk.com/id220156314.
  • : .: ------------, : www.ok.ru+ , id : 73633007, : ------------.
  • : 01.07.1929 .., : , . .10 .1
  • : : www.vk.com/id220388745.
  • Nala Kinderdagverblijf: .: 708885635, : , , 2562AJ, 's-Gravenhage, Beeklaan, 327.
  • : : www.vk.com/id146874624.
  • : 30.4 .., : , : www.ok.ru+ , id : 73559486, : : http://vkontakte.ru/app638461_73559486.
  • Cakmak Ozkan: 3.2.1986 .., : www.vk.com/id221185414.
  • : : p777asha, - .., : www.ok.ru+ , id : 73306588, : ,
  • : 04.02.1939 .., : , , , 76.
  • Ϊ Ѳ : : 3151916092, 18.04.1986 .., - .., : ,
  • "" ( ""): .: 27.03.2013 ., : 7718582559, : 1067746501503, : 771801001, : 45286565000, : , : 107140, , 1- , 3.
  • : 05.11.1933 .., : , . . 27, .: (495) 4716198
  • Ddfs Vlad: 1.2 .., : fchfg, : hfchfcg, hggfh - .., : fchfcgfc, .: dgdf, : gfghfgc, : www.ok.ru+Ddfs Vlad, : fghfchfcg, : ghfhfc, id : 73405094, : hfghfc, : gdfdg.
  • : 20.05.2000 .., : ,
  • : 02.10.1947 .., : , , , 25
  • : : www.ok.ru+ , id : 73302648,
  • : .: 89269613339 - - - - - (, , ..) - - - , - , - - - - 8-926-961-333-9 (, Skoda Fabia, 2009, , Skoda Fabia, 2009 . 55 000 - 59 999 , 1.6 , , , , : 420000 .), : , . -
  • : 31.05.1970 .., : - 43, .
  • : : www.vk.com/id221104384.
  • Choi Minjae: : www.vk.com/id220648527.
  • : : www.vk.com/id146830394.
  • : ., , .: 8 (8313) 229149
  • ' ò ˲: : 3161115757, 19.07.1986 .., в - .., : , ̲
  • Ergrqe Qegerg: : erwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwh gerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhg, : www.ok.ru+Ergrqe Qegerg, : erwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhg, : erwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwh gerwgwhgerwgwhgerwgwhgerwgwhg, id : 73712196, : erwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgwhgerwgw hgerwgwhgerwgwhgerwgwhgerwgwhg,
  • : : www.vk.com/id146769658.
  • : 29.12.1996 .., : , , -.
  • : .: 89263069895 - 26.04.13 : Yannis-Schneeprinz vom Weissen Blumchen ()- 2010- . http://ingrus.net/biewer/details.php?id=4659 Sunset Symfohony Luxus Lazuri -BOG2. -- . (, , , : , : 45000 .), : , .
  • ò : : 2421721535, 21.04.1966 .., - .., : ,
  • ˸: 26.3 .., - .., : www.vk.com/id220771358.
  • Ensong Jeff: : www.ok.ru+Ensong Jeff, id : 73781600,
  • : 17.8.1984 .., : www.ok.ru+ , id : 3081008,
  • : Hamilton Orthodontic Centre, 8513, Hospitals & Medical Establishments, Dentists, : , , 18 Auchingramont Road, Hamilton, Lanarkshire, Scotland, ML3 6JT, ML3 6JT, Scotland, Lanarkshire, Hamilton, .: 441698459922, www.all1smile.co.uk, : Mr George Campbell (Proprietor)
  • : 01.01.1944 .., : - , .
  • : : www.ok.ru+ , id : 3209816,
  • в: 30.06.1938 .., : , - 5941000000, , 56, : , 2106, 9126, 1980 .., : 21060398871.
  • : 7.1.1984 .., : www.ok.ru+ , id : 28056550,
  • : 17.1.1974 .., f\ - .., .: 3456788777, : www.ok.ru+ , id : 73674119, : www........
  • : 03.11.1988 .., : , . .28
  • : : www.ok.ru+ , id : 73740195,
  • : 30.11.1981 .., : , , , 17.
  • : : www.ok.ru+ , id : 73439365,
  • : : www.vk.com/id220187638.
  • : 1971 .., : , , 128.
  • " . : 80 .., : ., . .3, : PAJERO, 648954, 2003 .., : JMB0NK9403J007298.
  • : 18.01.1992 .., : ., --, , 136.
  • : 18.10.1928 .., : , , , 55
  • : : www.vk.com/id220331158.
  • : : 2663617835, 04.12.1972 .., ײ - .., : , ײ
  • : Lyme Regis Post Office, 6411, Shops & other Retail Outlets, Post Office Services, : , , 37 Broad Street, Lyme Regis, Dorset, South West, DT7 3QF, DT7 3QF, South West, Dorset, Lyme Regis, .: 441297442836, : Mr David Gilbert (Postmaster)
  • : 07.07.1956 .., : , . .17
  • ò : : 3149515614, 25.03.1986 .., в - .., : , в
  • Skyboo Fliptune: : kljcjxtybsrydxxrofomaboclbpqdlqecgapnxyvqfyymxexttcclxntimradmcksldfixgsyjyetjqubokuvjcuplnyiqnkvesferyurufpocsgkhtenirdftqvgwyfxylrdlmkiroljqaxjstjgwnguqykmcu ylopcwyecmexhcaesdkiiekwbebkkcgosnjbcvixqmgpmvrnmmdvhcgfypsitjcsxdikolaggnhvqojcjjwbvmwpeipayjkkx, : vsgvkcmdurbdccnpllsrrlnjitfqyuknnpmtaephhrasnminxwyadlvkatiugitchibdjofsfajopbxkhppxajoxvescywdvexkuleagqdjytfyelmgdujkepvusakojehlrvpldgsuveqdsbuqlegqgpsgecar wftrqqoahxrfblvfudyauelpfjsoykkbywafcrnqkcjnojfojifwbmxudrdtlimcwjmrdrquvxtpcjvcgmhapjefaksrucsuk, : gxsfillufhqruvnyygoiqpbjvjkvypbcosjpkbawduvdwivqvityqkfpkmpbqajwdvgxnxoenidyqisksbfxchwimcxeqjyfdsnxtjmlgwdivlmmdwenxcllbvceoxstpybxscwktxujwykrdbiuiuujrraiuosh jdynldwaqtyrphwxglmfunvrbdkqiidiwobppuwdvmskvjuvjduoigomblkiarvpfwnwtovafhascdnmrgqtnxlinwxxofjr, .: lwgjpcqqdowkltyu, : nlqushoyyqvtmxodghrbbflqeylkaogxhvfsgigvxcrotporreecgrhwmqfijdywfllibbujhhckxmwopbwpgtnamdtclctvbutwwioxxpwpqbshcbjvoikxfxwdwygglsbyuhlriweimcgsqvhnvipwfqlgdtil nqlmhghtxmoabpkwftitvlpfwndvtkrkesnfhsbimparwyqhwelvtjaqwgshlgsdlhhwmfcqkjdceiurvgqciomeojsfjnhk, : www.ok.ru+Skyboo Fliptune, : ypbvijmbgbthbjonksdpugmihmxvauijimpygsffbijuojppqogefhdetlthoitujedjstjaqkuagxbnmpmbohqgpiyxwoebtwgilvoudgnhmgikjjnrujmtobxsvrnjbnybmecghuhqosakjqhscguuxcjlbueq nmsohqdqvcptxgmeafuttamcybrbnsfucdljywdtwnfnasroaojbshofgtpbiconcrnnkfbcibpewmwfiojmiclubhpvebqr, : mjbbyusvpumadxmuaipcpmltfrwndesnvviweghnxfwhteuliuneffjtbhkckkfjyyvupvemlgsdhymokiafxblclwmmbrckgcmoonvoklpdhkynlavpkcewgcqgxjgqughrqxmxnxjiylnpxcarexhbqgqppqrl hrrhsfyclxmgqmemrukrxklatorwxhehvslbdgibywkpnwlxpxcjtucdufgvpuccafqwwivhpqlhffahvkcadnairrlvvbea, id : 73875336, : rhxtqqgalnkcxwlqjmhlrdjidqfenabcpsfpywrdesjawiomcjjdqtgycoxoiiqqdeharivqespddjfpimmlpskcaageqglnrivoelymnjewmdmtsohnqxvryhcbejaujbtgytvgrtdomfjciwlutcculuhlduw kusfcwxyjylcloblniboddsgnrikdanksbkoagpvdurticksncsifdcifybwpdqlflanotjivjllrrukpxglsoenifxarfeet, : http://cih.ms/.
  • : 31.03.1931 .., , . . 12 . 6, . (495) 4949275.
  • : : www.ok.ru+ , id : 73658117,
  • : 04.01.1960 .., : . -, -, ., 59, .: (812) 3421023.
  • : : www.vk.com/id146542252.
  • : :
  • : : www.ok.ru+ , id : 73082034,
  • : 16.11.1953 .., , . . 3 . . 3, . (495) 4935364.
  • : 3.6 .., : www.ok.ru+ , id : 73841704,
  • : : www.vk.com/id221098724.
  • : : www.vk.com/id220613092.
  • : : , - .., : , : www.ok.ru+ , : -, : , id : 73657539,
  • : 01.01.1961 .., : ., -, .
  • : 15.03.1988 .., . , . .428
  • : : www.ok.ru+ , id : 27985774,
  • : : www.vk.com/id220357001.
  • : 22.06.1902 .., , . . 9, . (495) 4749842.
  • : 04.06.1996 .., : . . , : , .
  • : 15.11.1982 .., : , 16
  • : : , 113035, , ., ., 32/34, 45
  • : 21.6.1982 .., : www.vk.com/id220525346.
  • : 7.11.1992 .., : , : www.ok.ru+ , id : 27813327, : .
  • : . .: 8 9065306673, : . . 30 10
  • ˲ : : 3043024595, 25.04.1983 .., в - .., : , в
  • : .: 89153608527 - () 1 , . (, 1- , , 1- , : 40000 .), : , .
  • : : www.vk.com/id220752457.
  • : .: 8 9024865330, : , -, 26-
  • Basirov Shamil: 7.5 .., Mahachkala - .., .: 07511434445, : www.ok.ru+Basirov Shamil, id : 73131306,
  • : 27.06.1972 .., : , , , 8 : " . ".
  • : : www.vk.com/id146632893.
  • : : www.vk.com/id220171132.
  • : 30.12.1940 .., : , .
  • : 01.12.1972 .., : , . .24 .1
  • : : www.vk.com/id220048388.
  • : 18.10.1943 .., : , . . 31, .: (495) 3567743
  • : .: *********, : www.ok.ru+ , id : 73200004,
  • : 05.08.1927 .., : , 453136
  • Fox Natali: - .., : www.vk.com/id146615671.
  • : ϲȪ "ʲ " ( "ʲ "), : , 19763 , Ͳ -, ˲, .: , 19763 , Ͳ -, ˲, .: Ͳ ̲Ͳֲ, 10051020000000045, 11.02.2005 ., : 1) 2783823150, ò, : : 99999 , : 01.25.0 i , ..: 50368 ..: 50368.
  • в Ѳ : : 2968523179, 10.04.1981 .., ʲ - .., : , ʲ
  • : Ambience, 5242, Shops & other Retail Outlets, Fashion Shops, : , , 87 Crouch Street, Colchester, Essex, Eastern, CO3 3EZ, CO3 3EZ, Eastern, Essex, Colchester, .: 441206570433, www.ambianceofcholchester.co.uk, : Mrs V Wheeler (Proprietor)
  • : 30.7.1987 .., : )))), - .., : ), : 12 , , , , : www.ok.ru+ , id : 73072417,
  • Haisma H: .: 561433114, : , , 8391HB, Noordwolde fr, Doctor Verdeniusstraat, 45.
  • : : www.vk.com/id221165693.
  • : 31031966 .., - .., : . . .44.
  • SUZHOU City WUZHONG District XUKOU LENGZUO Factory: : ZHU,JINHUA, : manufacturing . processing , sheet metal , machinery manufacturing ., : , 215164, Jiangsu, Suzhou, XUKOU Town, .: 66211678, 0512-66219731.
  • : .: 89617002376 (), : 650000 . . 0 .0
  • : 16.05.1981 .., : , . .39 .1
  • : 24.08.1974 ..
  • : .: 8 (3432) 332134, : ., . , 620017, . , 10
  • : 01.01.1900 .., : , - 5941000000, ., 8, : , 2140, 9402, 1981 .., : 962966, 775978.
  • : 09.05.1981 .., : , 368220,
  • : : www.vk.com/id220323212.
  • : 17.01.1932 .., : . - ., : , .
  • WUJIN City NIUTANG Town XINGGUANG Bulb Factory: : JI,XIAOPING, : , 213163, Jiangsu, Changzhou, QINGLIAN JIJIA Village, NIUTANG Town.
  • Fg Gff: : www.ok.ru+Fg Gff, id : 73757846,
  • : : ., . -, 6
  • : : 3400002817, 01.02.1993 .., - .., : , '
  • : 18.02.1990 .., : , .
  • : 22.09.1989 .., : ., ,
  • : : , .1649
  • : .: 8 9025575075, : , , 3
  • : : www.ok.ru+ , id : 3205905,
  • : : www.vk.com/id220739474.
  • : : www.ok.ru+ , id : 73349550,
  • ˲ : : 2690520090, 30.08.1973 .., - .., : , IJ
  • : 20.02.1910 .., : , .7
  • : .: 8 9089999176, : , , , 66
  • : .: 8 (812) 2100750, .: 2100750 (Tele2), : , , 37
  • : 18.08.1949 .., . , . .15
  • : 27.03.1966 - .., : , 2107, , 93456, 1994 .., : .12
  • : 22.07.1975 .., : , - 5940500000, , 7, : , 5203, 33920, 1983 .., : 0, 0076994.
  • : 02.03.1960 .., : , ., .1,
  • 7773 : : , : www.ok.ru+7773 , id : 73065183,
  • : : www.ok.ru+ , id : 73698906,
  • : 09.01.1964 .., : , . .11 .1
  • : 17.02.1935 .., : , : , .
  • : : www.ok.ru+ , id : 27753816,
  • : Halsnead Primary & Training School, 8021, School & Educational Establishments, Schools - Local Authority, : , , Whiston, Pennywood Drive, Prescot, Merseyside, Merseyside, L35 3TT, L35 3TT, Merseyside, Merseyside, Prescot, .: 441514308131, www.halsnead.demon.co.uk, : Mr C J Rowling (Head Teacher)
  • : : 2621619117, 11.10.1971 .., .ȯ - .., : , .ȯ
  • ò ²: : 3049426434, 28.06.1983 .., Ѳ - .., : , ˲
  • / 3 / : : , , , , 29, : 500, 8076, 1968 .., 152708.
  • : 28.10.1987 .., . , . .1 .1
  • : 29.07.1977 .., : , . . 6, .: (495) 7311206
  • : 21.8.1983 .., - .., : pogorelskiy_egor, : www.vk.com/id219991350.
  • !!! : : www.ok.ru+!!! , id : 27956706,
  • : : www.vk.com/id220936626.
  • : 11.12.1980 .., - .., : www.ok.ru+ , id : 73838905,
  • : 27.03.1997 .., : , . .22 .3
  • : 11.05.1991 .., . , . .57
  • : 29.01.1989 .., : , . 367-17.
  • : .: *******, : www.vk.com/id221166570.
  • : Be Laloo: : , 1602, Sint-Pieters-Leeuw, Dorp 1, .: 3225698122, : Weight-Loss And Beauty Centres.
  • : 1970 .., : ., . .
  • : 15.9 .., : www.vk.com/id220076669.
  • : : www.vk.com/id221065618.
  • : 20.3.1993 .., : , : www.vk.com/id146804803.
  • : : ., 5 .8
  • : 29.01.1966 ..
  • : 10.12.1991 .., : www.vk.com/id146756856.
  • : 30.03.1962 .., : , . .21
  • - : : , 10. : , 77773944
  • . ( ): .: 8 4236143025, : , ,,692330, 45
  • : .: 6356, : www.ok.ru+ , id : 27773210, : .
  • ..: : , 97 5
  • : : www.vk.com/id220709889.
  • : 12.2.1999 .., : www.vk.com/id220679276.
  • : .: 8 9617020864, : 650000 . - 113 .0
  • : 30.04.1955 .., : - , .
  • : 2.5.1991 .., : www.vk.com/id221066011.
  • : 02.04.1962 .., : , - . . 13, .: (495) 2120578
  • : 03.01.1971 .., : .97 . . , .: 3433352566, 9048680686, (.: 3433787245).
  • : 30.07.1980 .., : , . .5
  • : - "". : ., - . , -, P , , 12. : 3-16-89 3-20-63, 3-16-89 3-20-63. : 50000 .
  • Afanaciev Artur: 22.9 .., - .., .: 89173846641, : www.vk.com/id220306578.
  • : 02.06.1951 .., H - .., : , , 52.
  • ò : : 3154413536, 13.05.1986 .., в - .., : , в
  • : 16.09.1976 .., : 322132, 44102, , 40630A, 2001 .., : 32213210197807, 0197189, 0006885, 13007793, .: 68314, : , , , 10.
  • : 14.06.1941 .., : , . .4 .1
  • Ѹ: : www.vk.com/id220732811.
  • : 17.01.1935 .., : , . .7
  • : 13.9 .., : www.ok.ru+ , id : 3061044,
  • Nr Ainindiamks: 19.11.1998 .., : www.vk.com/id220755083.
  • : 3.9 .., .: , : www.ok.ru+ , id : 73278557,
  • : 15.09.1982 .., : ., . , . 3
  • ֲ ² в: : 3108017679, 03.02.1985 .., - .., : ,
  • : 26.09.1948 .., . , . .17 .1
  • : 28.3 .., - .., : www.vk.com/id220085764.
  • : . , . .26 .3
  • : .: 8 9046253247, : , , , 10
  • ..: , . . 20 ,
  • Berat Berat-Zengin: : www.vk.com/id220463622.
  • : 16.02.1999 .., : , ., 72.
  • : 23.11.1954 .., : - , ., .10-, 10
  • : : www.vk.com/id146658607.
  • Dishnievna Ihsan: 21.3 .., : www.vk.com/id220238453.
  • : : www.vk.com/id221122881.
  • : 19.07.1952 .., : . .69 .
  • : : www.vk.com/id146489756.
  • : 9.1 .., : www.vk.com/id146600265.
  • : : www.ok.ru+ , id : 73176230,
  • : 28.03.1950 .., : , . .9
  • : 08.04.1970 .., : 446660, , ., : 21140, , --, 41963, 21140043636619, 3636619, 3767329, 2004 ..
  • : : www.ok.ru+ , id : 73138559,
  • Mlivic S: .: 162423429, : , , 4901LZ, Oosterhout nb, Van Reesstraat, 14/A.
  • Hotre Persi: : 888866666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666633333333333333333333333333333333333333 333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333 33333333333333333333333333333333, : 888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888883333333333333333333333333333333333333333333333333333333333333 333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333 333333333, Ode$$a Citi - .., : 7777777444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444488883333333333333 3333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333 33333333333333333333333333333333333333333333333333333333, : 4555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555733333333333333333333333333333 3333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333 3333333333333333333333333333333333333333, : www.ok.ru+Hotre Persi, : 7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777733333333333333333333333 3333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333 3333333333333333333333333333333333333333333333, : 4444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444333333333333 3333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333 333333333333333333333333333333333333333333333333333333333, id : 73240097, : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$33 333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333 33333333333333333333333333333333333333333333333333333333333333333333,
  • "-" ( "-"): .: 24.03.2011 ., : 5261059897, : 1075261012342, : 526101001, : .2 .21.1 08.08.2001 129-, : 603009, , , -, 37.
  • : 7.8.1983 .., - .., : www.ok.ru+ , id : 3161396,
  • : 09.01.1972 .., : ., . -, 19
  • : 12.11.1999 .., - .., : www.ok.ru+ , id : 73671721,
  • : 1.2.1989 .., - .., .: +7, : www.vk.com/id146905177.
  • . : 26.6.1990 .., : , - (c), : Half-Life Andrenaline gamer 6.6, - .., : , : www.ok.ru+. , : :D, id : 3188436, : :),
  • Panamera Olga: : www.ok.ru+Panamera Olga, id : 73653523,
  • : : www.vk.com/id220263122.
  • : 18.07.1974 .., : , . . 5, .: (495) 3852658
  • : : www.vk.com/id220347826.
  • : 16.08.1981 .., : , . . 12, .: (495) 4126191
  • : 10.05.1967 .., , . . 19, . (495) 1137287.
  • ²˲ : : 2880119492, 08.11.1978 .., Ѳ - .., : , Ͳ
  • : 08.03.1967 .., : , 41
  • : 25.08.1950 .., : , -, , 1 : "".
  • : 04.10.1954 .., , . . 5, . (495) 2582045.
  • "" ( ""): .: 17.05.2013 ., : 7709567635, : 1047796694956, : 770901001, : 45286555000, : , : 101000, , , 12.06.2013.
  • : : , . . 19/1 ,
  • Jkl Kl: : www.ok.ru+Jkl Kl, id : 73832592,
  • : 30.08.1957 .., : , 17
  • : .: 8 9038569822, : 394000, . , . , .22
  • : : www.vk.com/id221070086.
  • Crown Yuri: 4.5 .., : www.ok.ru+Crown Yuri, id : 27995267,
  • : 05.02.1949 .., : , , /, , , 14
  • : 4.8.1979 .., : www.vk.com/id146549553.
  • : 14.08.1965 .., : ., . -, 13
  • : 27.05.1986 .., : - , .-, ., 79
  • : 01.06.1940 .., : , . .18
  • : .: 89617033155 (), : 654000 . . 6 .0
  • : 21.02.1991 .., : , , ., 34
  • Maksmaks9 Maksmaks9: : www.ok.ru+Maksmaks9 Maksmaks9, id : 73824506,
  • : : www.vk.com/id220548539.
  • : : www.vk.com/id146580031.
  • : 01.01.1957 .., :
  • : 04.08.1971 ..
  • : 29.9 .., - .., : www.vk.com/id220766374.
  • -21074 : : ----!!! ------!!!!, : ))))), - .., : -2107, : , : www.ok.ru+-21074 , : , : , RA , id : 3230033, : , : www.autolada.ru.
  • : 1907 .., . - - ..
  • : 18051966 .., : ., . .236, : X-TRAIL 2.0SE, 82164, 2007 .., : JN1TBNT31U0011495.
  • : 25.3 .., : www.vk.com/id146798331.
  • : 18.05.1963 .., : , .5 .2
  • : 17.01.57 .., : , , . , 10. : - "", 454081, ., 102
  • : : www.vk.com/id146580291.
  • Ͳ ²: : 3543001636, 01.01.1997 .., - .., : ,
  • : 25.04.1983 .., : , . .32
  • : 26.11.1937 .., : , , ( ).
  • Modzgvrishvili Lola: 20.8.1988 .., : www.vk.com/id146873818.
  • Bijanova Nastya: 13.3.1992 .., : www.vk.com/id220426652.
  • ?:) Kos: : www.ok.ru+?:) Kos, id : 73099747,
  • : 06041986 .., - .., : - . . .79
  • : .: 895203710**, : www.vk.com/id146503014.
  • : : www.vk.com/id220195774.
  • .. 77 75 (2000.02.01 ): .: 8 (473) 732894
  • : : www.vk.com/id220437608.
  • ..: : , . . 52 ,
  • Ͳ : : 1270316454, 12.10.1934 .., - .., : ,
  • Chernysh Pavlusha: : www.ok.ru+Chernysh Pavlusha, id : 73247306,
  • : : ., .1
  • : 23.1.1997 .., : www.vk.com/id146707875.
  • : : 3141713210, 06.01.1986 .., - .., : ,
  • : 22.09.1922 .., : ., . -, 4
  • : : , . . 10, . (495) 1940494.
  • : 25.05.2006 .., : ,,, : , .
  • : 10.10.1994 .., - .., .: 8920-**3-45-**, : www.ok.ru+ , : , )), id : 73814042, : )))) ),
  • : .: 8..9............20, : www.ok.ru+ , id : 73717957,
  • : 21.04.1964 .., :
  • : : www.ok.ru+ , id : 73869762,
  • : : , ., , 12,
  • : : www.vk.com/id220421787.
  • Malinovskaja Masha: : www.ok.ru+Malinovskaja Masha, id : 73614531,
  • : : www.ok.ru+ , id : 27781011,
  • Nishimoto pain clinic: : , Kinki/Wakayama, www: http://home.att.ne.jp/surf/nishimoto/, http://home.att.ne.jp/surf/nishimoto/, nisimoto@zam.att.ne.jp, : Health/Care Providers/Clinics/Anesthesiology/
  • : 25.8.1997 .., - .., .: , : www.vk.com/id221165357.
  • : : www.vk.com/id220132172.
  • : : ., .23,
  • : 22.07.1980 .., : , . .117
  • : 16.07.1981 .., : , . . 10, .: (495) 3392367
  • : 23.03.1955 .., : ., . -, 114
  • : 05.12.1939 .., . , . .33 .1
  • - : : , 11- . 34
  • : 15.01.1957 .., HH -H H - .., : , , 2.
  • : 12.2.1984 .., : www.vk.com/id221105703.
  • Ccc Ccc: : www.ok.ru+Ccc Ccc, id : 73622458,
  • : 28.06.1981 .., : . . , . 26
  • Moriset Alanis: 9.8 .., : www.vk.com/id220103580.
  • : 23.09.1980 .., , . . 65/32, . (495) 7049002.
  • : 24.09.1924 .., : ., . -, 4
  • : 04.01.1976 .., : ., . -, 4
  • : 01.01.1964 .., : ., , , 41.
  • : 14.08.1968 .., : , .
  • : 28.01.1921 .., : , - -, 60 , 15
  • : 09.07.1976 .., : , -, -, 3.
  • : 1970 .., : . , , , 14.
  • : 27.8 .., : trubina27, : www.vk.com/id146581178.
  • : 13.11.1951 .., : , , ( ).
  • : 27.02.1978 .., : , ., -, ., 21
  • ò ˲: : 2693218418, 26.09.1973 .., - .., : ,
  • : 11.01.1982 .., : , .
  • : .: 8 3952281411 (8 3952 281411), : , , , 239
  • : 7.3 .., * - .., : www.ok.ru+ , : Tokio Hotel, id : 73594105, : , , *,
  • : : www.ok.ru+ , id : 73360181,
  • : : www.vk.com/id221183627.
  • : 12.10.1952 .., : , 3
  • Plus Alezar: : www.vk.com/id220405280.
  • : 20.06.1940 .., :
  • Tdjkrkyuky Dshtdjfgjkgj: : www.ok.ru+Tdjkrkyuky Dshtdjfgjkgj, id : 73214600,
  • ..: : , . . 3 . 2 ,
  • YIXING City FANTAI Tour Development Co.,ltd.: : SHAO,KEPING, : tour organize planning , property management , arts & crafts , garments marketing, : , 214200, Jiangsu, Wuxi, No. 84, TONGZHENGUAN Road, YICHENG Town, .: (510) 7900329.
  • : 11.1.1971 .., - .., : www.ok.ru+ , id : 73197631,
  • : : 3081822396, 17.05.1984 .., - .., : ,
  • : . .: 8 9050668058, : 652840 . . 32
  • : : 1094810992, 22.12.1929 .., - .., : , .ȯ
  • : : ., .90
  • : 12.3.1984 .., - .., : www.ok.ru+ , id : 27852070,
  • : : www.vk.com/id220565125.
  • : 22.4.1988 .., : www.vk.com/id146726297.
  • в : : 3080623997, 05.05.1984 .., - .., : , ʲֲ
  • Efvwjyhe Jewvfjyhv: : www.ok.ru+Efvwjyhe Jewvfjyhv, id : 73795319,
  • : 23.04.2001 .., : , .23 .2
  • : - .., : www.vk.com/id146575699.
  • 15906 ֲ : : , - 5940136300, 0, : , 2417, 4957, 1990 .., : 0.
  • : : www.ok.ru+ , id : 73544037,
  • : 19.9.1985 .., - .., : www.ok.ru+ , id : 3215325,
  • : : www.vk.com/id146935813.
  • Fgfg Gfgfg: : www.ok.ru+Fgfg Gfgfg, id : 73736846,
  • Erbreb Aeeqtbn: : www.ok.ru+Erbreb Aeeqtbn, id : 73629427,
  • : : www.vk.com/id220815783.
  • : 19.08.1967 .., . - . - .., : . .-2 34
  • : 20.12.1997 .., : ,
  • : .: 8 9024833774, : , , 105
  • 10.01.1961 ..: : ., . . .15
  • : 230761 .., : ., 1 . .4, : 2107, 39364, 1992 .., : XTA210700N0679415.
  • : : sims , .: 89201080674, : , : www.ok.ru+ , : , id : 73091350, : ,
  • : .: 9062885377, : 000000 . . 15
  • : : , - - .., : www.ok.ru+ , id : 73566290,
  • : 04.07.1982 .., : ., ..
  • : 25.05.1994 .., : , , , 61
  • YANCHENG City YUEHU Materials Co.,ltd.: : YANG,QINGSHAN, : metals material , building material , material testing equipment, : , 224001, Jiangsu, Yancheng, No. 319, 317,, SANLOU, No.33, YINGBIN NAN Road, .: (515) 8369108.
  • : 27.01.1965 .., : . - ., : " 137" 5256021908, : , .
  • : 1904 .., . - - ..
  • : 13.04.1996 .., : , : .,
  • 03.05.1984 ..: : ., . .339
  • : 10.01.1910 .., . , 2- . .20
  • ( .): 15.08.1931 .., . - - .., : , : . -
  • : : www.vk.com/id220972797.
  • : 3.11211, (), , , -1, 3410, 1985 .., : , :
  • : 16.02.1960 .., : , . .6 .1
  • : 27.03.1959 .., : ., --, , 118.
  • : : . . 12, : , : 72, 6970, 1954 .., : 118633.
  • : : , 113208, , , .3, .2,
  • : 14.03.1986 .., : - , ., ., 13
  • Slepoy Slepoy: : www.vk.com/id220461762.
  • : 18.3.1996 .., : , !, - .., : ...))), : www.ok.ru+ , id : 27705894,
  • : 17.11.1984 .., . , . .4 .4
  • : 20.01.1944 .., : ., . -, 49
  • : : ,28-24
  • 01.05.1976 ..: : ., . .121
  • : 9.2.1987 .., : !!, - .., : !!! !!, : , !!!!!!!!, : www.ok.ru+ , : !!, : !!, id : 27785218, : !! !!,
  • ϲ в : : 2648521478, 06.07.1972 .., в - .., : , в
  • : 15.11.1936 .., : ,
  • : 18.06.1969 .., : , - - .2
  • : 21.06.1926 .., . , . .4
  • : : www.vk.com/id146728177.
  • : , . . 8 . 3 ,
  • Drozd Katarzyna: : www.vk.com/id146928890.
  • : . .: 8 9056230180, : . . - 39
  • : : 3401103070, 12.02.1993 .., Ͳ - .., : , Ͳ
  • : 01.01.1973 .., : ., , , 151.
  • _^_ Tektonik : 26.9 .., : CS, Warcraft 3, , NFS Most Wanted, - .., : , : 4 , 4, , , ( ), : www.ok.ru+_^_ Tektonik , : , Comedi Club, : DRAMM&,BASS ps, tektonik, hause DANSE!! ,, id : 27735074, : <,---!!!:):):):):)!!!!!!!!!!!!!,
  • Vikycik Banan: : vika-baxtina2@mail.ru
  • : 24.07.1966 .., : _!: , ,
  • : 26.7.1994 .., : ==>,>,^_^<,<,==, .: +375333931519 (MTS), : www.ok.ru+ , id : 73458278, : ask.fm/thetinymasterofevil.
  • Rathi Sumit: : www.vk.com/id220076133.
  • : 16.04.1958 .., : ., . -, 17
  • : 01.08.1911 .., : , , , , 20. : , : 58.
  • : 29.09.1937 .., : , . . 6, .: (495) 3708974
  • : .: 8 (921) 9152922, 442-11-59, 442-11-59, : C-, 8
  • 9051174127 PRE_PAY: .: 8 9051174127
  • : : www.vk.com/id146572504.
  • : 16.03.1992 .., : .,
  • : 09.01.1981 .., : 21154, -, 39852, XTA21154094725210, 2008 .., : , 2- 17
  • : 29.10.1932 .., , . . 7, . (495) 4405141.
  • : : www.vk.com/id220171103.
  • : 13.9.1992 .., - .., : www.vk.com/id220607219.
  • : : www.vk.com/id220240484.
  • : : , , 09.09.1954 .. .2
  • : : , : , - .., : , , .: , , : , : www.ok.ru+ , : , : , id : 73873305, : , : www*********.ru.
  • : : www.vk.com/id220812301.
  • : 7.1 .., : , - .., : , : , : www.ok.ru+ , : , id : 27978917, : ,
  • : 28.05.1924 .., : , . .45 .1
  • : 24.06.1956 .., : ., . . . 92.
  • : 02.10.2002 .., : . , ., 91.
  • : 14.10.1983 .., : , ..... !)))))), - .., : , .: 892734*****, : , , , : www.ok.ru+ , : -2, ........., : , id : 73500696, : !,
  • : : www.ok.ru+ , id : 73373661,
  • : 01.02.88 .., : , , . , 63
  • Subashini T G R: : -, WI, 12/44 Viharagama Weheragoda Wellampitiya
  • : 21.04.1976 .., : , - 5940136600, IJ, 51, : , 21063, 3069, 1993 .., : XTA210630R3132525.
  • ..: .: 8 (49657) 69020, : , . , 1
  • ͿY I-: 13.07.1976 - .., : , 1943000, 1943401, , 14, 16, : 21099, , R449BWM, 2902228, 2000 ..
  • : 11.04.1996 .., , . . 13, . (495) 4794542.
  • : 04.12.1978 .., : ., , , 19.
  • Tamerlan Aleksandr: 10.8.1988 .., : www.vk.com/id220996677.
  • D',avino Maria: : www.vk.com/id220188438.
  • : 5.8.1996 .., : www.vk.com/id220215790.
  • : .: 8 9027034530, : , , , 1
  • : 17.6 .., : Veni,vici,vidi., : GTA:SA, VC., - .., : , .: 0964310647, : Action, : www.ok.ru+ , : , id : 73134979, : , , , : http://vkontakte.ru/.
  • : : www.ok.ru+ , id : 73654779,
  • : 08.04.1968 .., : ., , , .45/1
  • : : www.vk.com/id221064414.
  • : 15.06.1986 .., : , . .14 .2
  • : 20.3.1995 .., : :D, : www.ok.ru+ , id : 28038436, : www.pizhamka.com.
  • : 31.03.1953 .., . , . .14 .2
  • : : , : Need for speed undegraud2, god of war3, mark Ecko getting up, - .., : , , : , , , . , . , : www.ok.ru+ , : . , : Clubdance, rap(cao), -, , , guf, TAHDEM, -Q(reggi), , id : 28050098, : , , , , : www.xyi.su.
  • : : www.vk.com/id221062596.
  • : 12.07.2002 .., : , , , ., ., 59
  • : : www.ok.ru+ , id : 73259742,
  • : : 3085322858, 21.06.1984 .., - .., : ,
  • : : www.vk.com/id219995489.
  • ..: , . . 3 . 3 ,
  • : 21.09.2000 .., : , , , 9
  • : 11.03.1956 .., : , , , 2
  • : 04.02.1976 .., : 456550, , . , . , . 82, .: 89507334609, : (:456550, , . , . 30 , . 147, ) : (.: 83515230039).
  • : 08.03.1939 .., : , . . 7, .: (495) 2074428
  • : 01.01.1958 .., : .,
  • : 1918 .., : 9. :
  • : 23.12 .., : www.vk.com/id220394233.
  • : 25.05.1985 .., : , . . 42, .: (495) 3486601
  • : : , . . . 23 . 2 ,
  • : 25.12.1948 .., : , - 5621882003, ., ., : VOLKSWAGEN, CARAVELLE, 34400, 1986 .., : WV2ZZZ257GH066587.
  • : 20.03.1931 .., : , . .11 .1
  • Hernandez Perez Jose Fulgencio: .: 286210, : , PLAYA, 206 #13102 e 131 y 133,PLAYAMATANZAS
  • : : fdfghdgfdjhgdj, : gfshgfdjgfjg, : fshgfjdfjdhdg, .: 2435432, : fhgfsgffshsggh, : www.ok.ru+ , : fsdhfdgfjhgkjhgjgh, : hgfdhgfhgsfsh, id : 73177438, : gfhdgfdjhygd,
  • WUJIANG City WANPING Town Herding Veterinarian Station: : LI,KAIFA, : livestock products , technology cosulting service, : , 215223, Jiangsu, Suzhou, KAIFA XI Road, WANPING Town, .: (512) 3391303.
  • : 20.07.2000 .., : ., . . . 1.
  • 9069862809 PRE_PAY: .: 8 9069862809
  • : : www.ok.ru+ , id : 73670647,
  • : 11.08.1959 .., , . . 8, . (495) 2164885.
  • ? : : www.ok.ru+? , id : 73637380,
  • - --: : www.vk.com/id219995634.
  • : 22.12.1922 .., . , . .52
  • : 3.12.1986 .., - .., .: 89179003679, : www.vk.com/id146810037.
  • : : www.vk.com/id221097703.
  • : : www.ok.ru+ , id : 73243822,
  • : 16.12.1926 .., , 1- . . 4, . (495) 2474793.
  • WUXIAN City Iron & steel Factory Materials Company: : PAN,SHIDI, : metals material, : , 215101, Jiangsu, Suzhou, CHUANZHAQIAO NANTU, SHIMUDU Town.
  • : : www.vk.com/id146590175.
  • : 7.2.1994 .., : #25, ) - .., : www.vk.com/id146908108.
  • : 13.04.1987 .., :
  • : 05.01.1992 .., : , . .35 .1
  • : 17.01.1968 .., : , , , 20
  • , , : 2105, 0472672, 38279, 1984 ..
  • 13.07.1988 ..: : ., . 148 .6
  • : 24.1.1998 .., .: 87004*2***2, : www.vk.com/id220748316.
  • : .: 8 9069301971, : 650099 . - 11
  • : 01.12.1999 .., : ., . , . 19
  • : : www.vk.com/id220851283.
  • "" ( ""): .: 23.10.2008 ., : 7107082009, : 1047101126577, : 710701001, : 70401380000, : , : 300041, , , , 05.02.2013.
  • : 17.2.1964 .., : www.vk.com/id220175814.
  • : 22.4.1996 .., - .., .: 89053726**, : www.vk.com/id220696597.
  • : .: 8 9065294651, : . . 55 .
  • : 15011973 .., - .., : - - ..
  • ˲ ˲: : 3114317919, 07.04.1985 .., - .., : ,
  • : : 1037739476004, "-" 7732115637 1037739476004
  • : 19.4.1995 .., : conter strike, LineAge 2, WoW, GTA ........, - .., : , : ., : www.ok.ru+ , : , : drum n bass, hause, id : 27724226, : ,
  • : .: 89145256660 (), : . (.), ,
  • "" ., -: . .., : 5334 -101, , 61336, , 1990 ..
  • : 20.10.1983 .., .: 8 9098105128 - , : ., 676450 46 . 52
  • : : www.ok.ru+ , id : 73239755,
  • : ..: 8 9050391635, : , 420000 . . 3
  • : 30.1.1988 .., : , .... ... , : , , a , - .., : , , .: 375292909485, : , , , , : www.ok.ru+ , : Sky ring, Rasha, camedi club, : , id : 73209938, : , : Hutt:/.
  • : 17.10.1971 .., , 1- . . 101, . (495) 1682495.
  • : 08.01.1983 .., : ., : "-6" 5257072937, : , .
  • : ..: 8 9172549826, : , . , 40, . , . , , 420000
  • : : www.ok.ru+ , id : 3229118,
  • : 11.03.1985 .., : . ., : " " 5249068126, : , .
  • : 15.01.1974 .., : , .5
  • : 01021960 .., - .., : - .Ҩ . .1
  • - : ' ' ( ), : , 041114 . .. - - 167, .: 330656.
  • : 28.04.1936 .., : ., . -, 86
  • : : www.ok.ru+ , id : 3081568,
  • Sancak Turkan: 1.1.1990 .., : www.vk.com/id220302537.
  • .. - , : -2830 162, : " ", : 125171, ., , ., 16, .2, : - 730-44-33, : , /.: - , MAZDA
  • : 5.5.1970 .., : www.vk.com/id220404720.
  • ..: : , -, 16, .: 8 (4152) 122986.
  • : 17.06.1987 .., : ., , . , , .21
  • : 02.12.1966 .., : 652164, , -, , ., . .124--
  • Weinstock Moti: : www.ok.ru+Weinstock Moti, id : 73154549,
  • Golubeva Vera: : www.ok.ru+Golubeva Vera, id : 3217240,
  • : 05.01.1971 .., : , . .2 .1
  • id13563883: : JuliaDanidyuck@yandex.ru
  • Efgeg Saha: - .., .: 03, : www.vk.com/id146748544.
  • : 02.08.1940 .., : , , , 8.
  • : , . . 26, . (495) 7166326.
  • : : www.vk.com/id220365144.
  • : 16.11.1963 .., : , .
  • : 04/28/78 .., : ., . , , 144
  • ò : 31.12.1976 .., : , - 5640100000, ., 18, : , 2108, 58757, 1992 .., : TA210830N1023358.
  • ʲ : 26.11.1949 .., : , - 5620855100, , 17, : , 21063, 53146, 1990 .., : TA210630L2443975.
  • : 19.01.1965 .., : , . 131
  • : 08.04.1994 .., : , - , , 36.
  • : .: 8 9246428960, : , . ;, 6""
  • : : , : andrey.voloshin95@inbox.ru
  • : 24.09.1972 .., : . -, -, ., 14, .: (812) 5873277.
  • William Dean: : www.vk.com/id220975243.
  • Gdwe63256 Bqneghw2efh32f: : www.ok.ru+Gdwe63256 Bqneghw2efh32f, id : 73420373,
  • : 30.09.1983 .., :
  • : - .., .: 8910********, : www.ok.ru+ , id : 73176389, : .
  • : :
  • ZHANGJIAGANG City YANGSHE HONGDA Electronic equipment Store: : ZHANG,JUN, : electronic spare parts retail , consume electronics service, : , 215600, Jiangsu, Suzhou, No. 4, XIAOHEBA Road, YANGSHE Town, .: (520) 8219125.
  • : 24.01.1979 .., : ., , . , , .17
  • : 07.02.1983 .., : .
  • : 9.4.1979 .., - .., : www.ok.ru+ , id : 27821014,
  • : 23.04.1957 .., : ., , . , , .199
  • : .: 8 (3812) 295405, : , 5 209.
  • : 12.2.1998 .., Thessaloniki Greece - .., .: iPhone, : wanna talk ??, : www.vk.com/id220089447.
  • : 01.02.74 .., : , , . , ., 2. : , 456010, . , ., 6
  • : 19.12.1973 .., : / .
  • : 12.3.1990 .., : , ,, - .., : , , : X, , : Dashka199096, : www.ok.ru+ , id : 3120474, : ,))).
  • Mustafa Elmi: 1.9.1999 .., ?? - .., .: +77714974535,+7702527618, : www.vk.com/id221102446.
  • : : www.ok.ru+ , id : 3215913,
  • : : www.vk.com/id220175109.
  • : 10.09.1946 .., : , , , 15 15.
  • "-" ( "-"): .: 06.12.2008 ., : 7716502565, : 1047796014078, : 771601001, : 45280556000, : .2 .21.1 08.08.2001 129-, : 129344, , , 6.
  • : 04.07.1984 .., :
  • : .: 1734389, : , , -. - 8 . 37
  • : . .: 8 9601112464, : .. . 39
  • : 31.5 .., : www.ok.ru+ , id : 73855786,
  • : 15.12.1988 .., : www.ok.ru+ , id : 73142628, : http://vk.com/kapan88.
  • : 24.02.1931 .., . , . .76 .2
  • : 9.10.1987 .., - .., : www.vk.com/id220164900.
  • : : www.ok.ru+ , id : 73231744,
  • ..: , . . . 7 ,
  • =))) : : www.ok.ru+=))) , id : 27925296,
  • : : www.vk.com/id220588321.
  • : 8.7 .., - .., : www.ok.ru+ , id : 73130780,
  • : 15.08.1948 .., . - - ..
  • : , . . 225 ,
  • : TOYOTA SPRINTER CARIB, (), , , , 44125, 1986 .., : , :
  • : : www.vk.com/id146856629.
  • : 09.06.1992 .., . , . .3
  • : 16.05.1980 .., : , 50 - 31
  • " " ( " "): .: 27.01.2011 ., : 7734226212, : 1037700170826, : 773401001, : , : 123585, , , 15.
  • : 22.05.1983 .., H - .., : , , 31.
  • : 01.01.1900 .., : , - 5923255100, 3 , 2, : , 1036, 7383, 1984 .., : 0, 344822.
  • : : 3057221278, 14.09.1983 .., - .., : ,
  • : 30.11.1922 .., : , ., -, - ., 130
  • : 24.11.1998 .., .: 8911......, : www.vk.com/id146822679.
  • : : www.vk.com/id220208720.
  • : 06.02.1969 .., : , , , 51
  • Sevillano Coronado Maria: : 28042, Madrid, .: +34 913.055.212
  • : : www.vk.com/id220931239.
  • : : --> -, : .
  • : . .: 8 9059111699, : 652210 . . 1 .
  • : : , . , 32, .: (8) 9106642790.
  • : : www.ok.ru+ , id : 3125238,
  • : 1.1.1988 .., - .., : www.vk.com/id220981096.
  • : 6.5 .., : www.ok.ru+ , id : 73349372,
  • : : , - .., : www.vk.com/id146901376.
  • : .: +79033134446, +78435203671, : 420133, , ,
  • IJ ²˲ : 20.08.1974 .., : , - 5640300000, , 63, : , 2101, 8414, 1972 .., : BA 2101-3519424.
  • : . .: 8 9065445848, : . . 46
  • : : 2993419839, 15.12.1981 .., ʲ - .., : , ʲ
  • : 01.01.1949 .., : ., --, , 41.
  • : 11.05.1937 .., : , - -
  • : 21.09.1961 ..
  • : .: 8 9147028005, : , , 14
  • : : 1077761804141, "" 7722627700 1077761804141
  • : 31.1.1982 .., : www.ok.ru+ , id : 3117923,
  • Proshina Snezhana: 12.11 .., : www.vk.com/id146538627.
  • : 11.01.1987 .., : ., . -, 2 .
  • Kant, Gijs en Marjon: .: 532010160, : , , 7545DX, Enschede, Paulus Potterstraat, 68.
  • : - .., : www.ok.ru+ , id : 3070331,
  • : : www.ok.ru+ , id : 3095755,
  • : : www.ok.ru+ , id : 73836686,
  • Bergsma H: .: 592342508, : , , 9403RX, Assen, Kornalijnstoep, 56.
  • : 19.08.1987 .., : ., . -, 4
  • Phoenix Rainbow: : www.vk.com/id220211446.
  • - : 5.1.1984 .., : , - .., : , : , : www.ok.ru+- , : , : , id : 73816982,
  • Ѳ: : 3094719777, 23.09.1984 .., - .., : ,
  • : 16.08.1935 .., : ., , , .7 .1
  • : : www.ok.ru+ , id : 73283562,
  • : 15.5.1991 .., - .., .: 89514281365, : www.vk.com/id220786843.
  • : : www.vk.com/id220554848.
  • : 20.04.1980 .., : , . .35
  • : .: 8 9601393892, : 396000, . , . , .16
  • : : www.vk.com/id220271077.
  • Guygugu Jbuyug: : www.ok.ru+Guygugu Jbuyug, id : 73082907,
  • : 28.12.1973 .., :
  • : 25.2 .., : www.ok.ru+ , : kristyusha2502, id : 73109936, : ask.fm/id73109936.
  • : 02.01.57 .., : , , 172.
  • : 1929 .., : 13. :
  • : .: 9211791106, 388134, : , , 39; : , , 39
  • : 01.01.1951 .., . , 24
  • : 22.05.1922 .., : , , , 28
  • : - .., : www.vk.com/id220172242.
  • : 25.05.1995 .., : , , , 11. : 4 (), : ., , 73.
  • : .: 8 9059144184, : 652150 . . 1
  • : 25.1 .., .: .., : www.ok.ru+ , id : 73286898,
  • : 07.06.1995 .., . , . .18
  • : 25.05.1946 .., : , .
  • : 25.01.1976 - .., : , 19010004, 19012684, , , 15, : 21093, , Z310RCM, XTA210930S1723746, 1995 ..
  • : 1972 .., : , , 15.
  • : 09.01.1948 .., - - .., : - 11
  • : : www.ok.ru+ , id : 73807188,
  • : 27.07.1948 .., : , . . 3, .: (495) 4990764
  • : 08.02.1968 .., : , . .25 .1
  • : : www.ok.ru+ , id : 73441817,
  • : 24.11.1963 .., : , - 5940400000, .ί, 72, : , 2108, 63053, 1987 .., : XTA210800H0210452.
  • : 11.06.1957 .., H . H -H - .., : , , () 30.
  • : : www.vk.com/id220202751.
  • Vk Aziz: : www.vk.com/id220889756.
  • : 18.09.1973 .., : 2109, 76302, , 1993 .., : 2109301294901, 1294901, 1309175, : , , , 19.
  • : : 1067746980333, "" 7721562390 1067746980333
  • : : , . , ., 224, .: 0/+380 (62) 611761.
  • : 02.03.1980 .., : ., , ., .193
  • : : www.vk.com/id146927316.
  • : 24.04.1976 .., : ., . -, 42
  • "" ( ""): .: 09.09.2011 ., : 7723717018, : 1097746297770, : 772301001, : 45286570000, : , : 127051, , . , 9.
  • : 1.4 .., : , : , : , .: 354535435454, : , : www.ok.ru+ , : , : , id : 73540264, : , : 235611.
  • A: : ., 21061 ( ), - , 1997 .., : , : 21140, 4632109, 3852553, XTA210610V3852553, :
  • Trask Alex: : www.ok.ru+Trask Alex, id : 73587569,
  • Ͳ в : : 2192426398, 10.01.1960 .., - .., : , Ͳֲ
  • : 16.09.1924 .., : , . .8 .4
  • : 01.01.1958 .., : , . .2 .4
  • : : www.vk.com/id220486239.
  • : 08.11.1947 .., . (495) 2051016.
  • : 16.6.1994 .., : - , - .., : www.ok.ru+ , : barataevboy, id : 27975085, : http://sprashivai.ru/Vaginaya.
  • : : www.ok.ru+ , id : 73272408,
  • : 01.01.1964 .., , . . 4 . 2, . (495) 4848768.
  • : .: 89059092602 (), : 652600 . . 71
  • ʲ в ²: : 3172811059, 13.11.1986 .., ˲ - .., : , '
  • : : ., . -, 76
  • : 22.06.1988 .., : , . , , 16. : ,
  • : 11.10.1979 .., : / .
  • : .: 65165, : www.ok.ru+ , id : 73606728,
  • : 11.11.1984 .., : 3. : .
  • ..: .: 1917286, : , , . . 166
  • - 09.06.1983 ..: : ., . . .14
  • : 18.03.1957 .., .., : 1216010765,
  • : - .., : www.vk.com/id146567410.
  • : 1.11.1993 .., : www.vk.com/id220232724.
  • : 05.09.1962 .., : , . . 3, .: (495) 3562206
  • : .: 8-921-5330043 (), : ., .,.- -., , 11
  • : .: 8 (342) 335156, : . , , 130
  • : 21.06.1975 .., . , . .11
  • Uitfiy Jyuh: .: ............., : www.ok.ru+Uitfiy Jyuh, id : 73177102, : ................
  • Sen Alex: 10.10.1995 .., : www.vk.com/id220049233.
  • : 3.5.1992 .., : , .: 8960..4908, : www.ok.ru+ , id : 73445197, : http://.
  • : 2.12.1999 .., : www.vk.com/id220173053.
  • : : 830304675, 25.09.1922 .., - .., : ,
  • Napso Diana: 5.5.1995 .., : www.vk.com/id146689465.
  • ? : 14.8 .., - .., .: 0930498203, : www.vk.com/id220591337.
  • () : 8.7 .., : www.vk.com/id146527539.
  • : 3.1.1964 .., - .., : www.ok.ru+ , id : 73430762,
  • : 20.6.1965 .., : www.vk.com/id220834374.
  • : : www.vk.com/id220074278.
  • : : -, . , .: 8 (8672) 443517.
  • : .: 8 9050423846, : . . 3
  • : 01.02.55 .., : , , . , -. , 81. : " ", 455000, . , 93
  • : 11.09.1952 .., : ,
  • : 17.04.1952 .., , . . 19, . (495) 9421104.
  • WUXI City Suburb HUANGXIANG HUACHANG Chemical fibre machinery Sales department: : ZHU,MINJUAN, : chemical fibre machinery fittings , machine for electrical appliance , ordinary machinery , hardware decoration, : , 214000, Jiangsu, Wuxi, No. 8-9, TAIHURAN ZHENGCHANG CHANGMEN NANMEN, FENGXIANG Road, .: (510) 3707443.
  • : : www.ok.ru+ , id : 73083462,
  • : : , ! =), : , - .., : , .: , : , : www.ok.ru+ , : , : Drum n Bass MinimalTehno Electro, id : 73354095, : .
  • : 22.09.1948 .., : , .14
  • : 19.10.1973 .., : , , , 5
  • : 09.01.1979 .., : - 9, , .
  • : 24.05.1970 .., : ., , , 16.
  • : 28.2.1999 .., : www.vk.com/id220767788.
  • : 27.4 .., - .., .: +3754455*****, : , : www.vk.com/id220378579.
  • : 21.05.1950 .., . , . .5 .3
  • : 06.06.1951 .., : ., . -, 3
  • : 27.11.1999 .., - .., .: 89153686152, : www.vk.com/id221166128.
  • Kolesnikov Ivan: : www.vk.com/id220740186.
  • : 00.00.1954 .., : . 60 .9
  • : : www.ok.ru+ , id : 3080230,
  • : 13.5.1982 .., : www.ok.ru+ , id : 27738073,
  • : 10.4 .., : www.vk.com/id146782594.
  • : 01.01.1922 .., : ,
  • : 1.1.1975 .., : www.vk.com/id146510133.
  • : 20.07.1923 .., : , . .20
  • : , . . 33 ,
  • : 20.03.1966 .., : ., . -, 20
  • 123sa Asdasd: : www.ok.ru+123sa Asdasd, id : 73165460,
  • : 25.05.1998 .., . , . .6 .4
  • : 2.6.1996 .., .: Samsung, : www.vk.com/id220610603.
  • : .: 8 (4872) 252819, : , , , 70
  • : 14.01.1915 .., : , . . 24, .: (495) 2074309
  • 03.11.2006 ..: : ., . .49/63
  • 01.03.1910 ..: : ., .
  • : .: 8 9069340641, : . . 24
  • : : www.vk.com/id220878329.
  • : ..: 8 9093062356, : , 422110, . , . , .8
  • в: 11.09.1969 .., : , - 5922086401, 0, : , 2102, 58503, 1984 .., : XTA210200E0639607.
  • : 05.01.1973 .., : , . -., , . , .19,
  • : 23.12.1969 .., : , . .7
  • : 010863 .., : ., . .71, : 80, 645397, 1983 .., : WAUZZZ81ZDA158181.
  • : : www.ok.ru+ , id : 73201762,
  • : : www.vk.com/id220155157.
  • ϸ: : , : , - .., : , .: 12344, : , : www.ok.ru+ ϸ, : , : , id : 73141277, : ,
  • : : www.vk.com/id220242675.
  • : 1.3 .., : www.vk.com/id220862024.
  • : 01.05.1948 .., : ., . -, 2
  • : 15041955 .., - .., : - . .16
  • : 20.07.1958 .., . , . .24
  • : : www.vk.com/id220548015.
  • : 28.12.2000 .., : , . .24 .2
  • : 04.04.1983 .., : . . : , 43.
  • : 01.02.64 .., : , , .50- , 4. : " ", 454047, . , 14
  • : 05.06.1942 .., : , . . 7 . 3, .: (495) 3814087
  • : 01.01.1965 .., : ., --, , 58.
  • : 4.10 .., : www.vk.com/id220459495.
  • : : www.ok.ru+ , id : 73372121,
  • Fsasaf Wasfa: : www.vk.com/id146758512.
  • : : www.ok.ru+ , id : 27869741,
  • : 4.10 .., : www.ok.ru+ , id : 3179354,
  • : : www.ok.ru+ , id : 73199834,
  • : .: 89059197760 (), : 652870 . . 2
  • : : www.vk.com/id220306881.
  • : 01.01.1900 .., : , - 5920986001, ., ., : , 6114, 2615, 1990 .., : 0, 01663989.
  • : : www.vk.com/id220969522.
  • : : www.ok.ru+ , id : 73656600,
  • : 03.05.1948 .., : , . . 4 . 2, .: (495) 2158750
  • : : www.ok.ru+ , id : 73461117,
  • HONGZE County HUAINING Garage: : WEI,LINZHANG, : automobile , farming machines and tools repair ; spare parts and fittings , automobile , fittings for agricultural machinery and farm implements marketing ., : , 223100, Jiangsu, Huaiyin, JIEDAO, ZHUBA Town, .: (517) 7633051.
  • ² ̲: : 3075821253, 18.03.1984 .., ˲ʲֲ - .., : , ˲ʲֲ
  • : 11.09.1946 .., : ., .- . - 58, .: 8 (812) 5577766, : 2106, 7654, 0000 .., : 4488170.
  • : 19.08.1982 ..
  • : : www.vk.com/id146813048.
  • Sadas Sada: : www.ok.ru+Sadas Sada, id : 73481778,
  • Rabobank Centraal Plateau Limburg: .: 455657000,
  • : 3.2.1998 .., : www.vk.com/id220518437.
  • : .: 8 9146851282, : , ,, 60
  • : 21.02.1954 .., : . -, -, ., 94, .: (812) 1227401.
  • Tyremuratov Bekzat: : www.vk.com/id221161497.
  • : 28.11.1975 .., : . . 133, : AUMAN FOTON KUNLUN, 69143, 2007 .., LVBDLPJB37H012806. : 612600 . . 1, : -8551, 315743, 1990 .., : 613152 . . 6, : -3205, 21643, 1993 ...
  • : 02.02.1958 .., : , , 7.
  • : 09.05.1964 .., : , , , 7, 7.
  • : 4.3.1991 .., : www.vk.com/id220869642.
  • : .: 89067480281 - Asos. , , , . uk10 ( 44). , . ( , Asos, , , , : > : , : 1500 .), :
  • : 21.08.1978 .., : , . . 61 . 2 . . 61 . 2, .: (495) 2845390
  • : 13.12.1953 .., . , . .8 .2
  • VENETO: : -, (), 41207, Abu Dhabi, @-www: veneto@eim.ae, : 97126811119, : Mens Footwear Trading
  • : 11.1 .., - .., : www.ok.ru+ , id : 73149913,
  • : - .., .: +79215144026, : www.vk.com/id220933145.
  • : 1900 .., . - ..
  • : : www.ok.ru+ , id : 73456184,
  • : 8.9 .., : ? ? ?, : www.ok.ru+ , id : 3096122,
  • : 18.3.1991 .., : www.ok.ru+ , id : 27845453,
  • : 05.03.1980 .., : , , , 178
  • : 22.11.1938 .., : , 2- . . 17, .: (495) 3600951
  • : 27.08.1958 .., : , , , 16
  • : : 3054923371, 22.08.1983 .., Ͳ - .., : , Ͳ
  • : : www.vk.com/id220885436.
  • : : 450015, , ., , 34, 4
  • : 10.12.1998 .., : www.vk.com/id220344152.
  • : 09.09.1958 .., : ., , , .10
  • : 29.04.1982 .., : , . .70 .3
  • : 17.08.1951 .., , . . 86, . (495) 1389940.
  • Amezquita Gonzalez Rumualdo G.: .: 42207068, : , Camacho, Santa_Clara, G.Rodriguez 29 e\Ave.de Paez yCarr.de Sagua Camacho Santa_Clara
  • : 06.10.1987 .., : , .
  • ..: : ., . , 40, .: 8 (3842) 44101.
  • : 9.9 .., : www.ok.ru+ , id : 28062968, : http://vkontakte.ru/app711674_28062968.
  • : : 1062711314, 04.02.1929 .., - .., : ,
  • : .: 8 9147072542, : , , 42
  • : : www.vk.com/id220738716.
  • : 22.07.1933 .., : , . . 52 . 3, .: (495) 3298393
  • : 20.9.1997 .., : www.vk.com/id221151819.
  • Bakk Hak: : www.vk.com/id220463481.
  • : 5.2.1993 .., .: 8951176543#, : btich31, : www.vk.com/id220520862.
  • "" - "": , , : 7714543693
  • : 18.11.1976 .., : , , , 93
  • Imansonsix Imansonsix: : www.vk.com/id220241389.
  • ˲ : : 2644720157, 29.05.1972 .., в - .., : , в
  • : 3.2.1987 .., : , : www.vk.com/id146572761.
  • : : 3032524354, 10.01.1983 .., - .., : ,
  • : 13.10.1908 .., : , . . 6, .: (495) 9546086
  • : 15.11.1960 .., : 2106, 75902, , 1982 .., : 2106003505688, 3505688, 5841339, : , , , 85.
  • : : www.vk.com/id220616760.
  • : 01.01.1947 .., : , . .19
  • : 04.03.1982 .., : - , .
  • : 05.01.1957 .., - .., : , . . 3, ( : , , , , 3, 42).
  • : 06.07.1931 .., , . . 2 . 2, . (495) 9462875.
  • : 23.12.1976 .., : www.vk.com/id221207098.
  • : 13.08.1959 .., , 15- . . 29 . 2, . (495) 4632212.
  • "" ( ""): .: 26.07.2010 ., : 7705708772, : 1057749661958, : 770501001, : 45286560000, : .2 .21.1 08.08.2001 129-, : 115054, , , 19.
  • : 01.01.1959 .., : 2106, 40902, , 2106, 1995 .., : 210610S3425366, 3425366, 3702299, : , , , 3.
  • - "" - "": , : 0 ., ./: 437-29-00, 437-29-00, : - , : 0, : 47940420, : , : 189640, 189640, 437-29-00.
  • : 11.4.1970 .., - .., .: , : www.ok.ru+ , id : 73191057, : . 3000 . . - Webmoney.,
  • : 18.01.1947 .., , . . 37 . 2, . (495) 3432655.
  • (((((((((( : 10.4.1991 .., .: iPod, : www.ok.ru+(((((((((( , id : 73468368, : *.
  • : 01.07.1962 .., : ., --, , 45.
  • Heuschen A J: .: 104143980, : , , 3012GH, Rotterdam, Karel Doormanstraat, 469/C.
  • : 13.08.1966 .., : , , 2- 23.
  • : : www.vk.com/id146594390.
  • : 21.09.1985 .., : . , ., 25. : " ", : , 682732, , -.,., : , .: 74-96-61,74-96-62.
  • : 12.12.1985 .., : www.ok.ru+ , id : 3110625,
  • : , 147, .: 8 (3812) 302119.
  • : : , - .1
  • : : www.ok.ru+ , id : 73068056,
  • : 11.04.1996 .., : , . .2
  • : : www.vk.com/id220010305.
  • : 02.04.1968 .., : , 45
  • : : www.ok.ru+ , id : 73518992,
  • : 26.12.1934 .., : , 453186
  • : 19.3.1998 .., : www.vk.com/id220180096.
  • : 21.08.1962 .., : ., . -, 4
  • : .: +79604642114, +78639622938, : , 347141, , , - , -3, 9
  • в : : 3132416077, 05.10.1985 .., -˲ - .., : , -˲
  • : : , 31
  • : 18.12.1929 .., : , , , 4.
  • HONGZE County HUANGJI Town Cooperation Economy Business Management Station: : MA,HANCHENG, : village & town financing management ., : , 223112, Jiangsu, Huaiyin, HUANGJIXIN Street, HUANGJI Town, .: (517) 7611015.
  • в : : 3174011513, 25.11.1986 .., ² - .., : , ²
  • : 16.1 .., : , . , : , - .., : ......., .: 89101590450, : , : www.ok.ru+ , : , ..., id : 73440629,
  • ij: 10.7.1998 .., : www.vk.com/id220261089.
  • : 26.5.1960 .., - .., : www.vk.com/id220340706.
  • : 27.10.1963 .., : , 18-1
  • : 16.2 .., - .., : www.vk.com/id220520253.
  • : 19.11.1995 .., : 607496 . , : , .
  • : : , . . 21 . 3, . (495) 4266816.
  • : 03.05.1961 .., : ., . -, 9
  • : 12.07.1970 .., : - 42, , . : "".
  • : 24.2 .., : www.ok.ru+ , id : 27799578,
  • : : Blackfish, - .., : www.ok.ru+ , id : 73430006,
  • : : www.ok.ru+ , id : 73097077,
  • : 26.9.1995 .., - .., .: 89178741559, : www.ok.ru+ , id : 73192559,
  • : 8.4 .., : www.ok.ru+ , id : 73337087, : http://vkontakte.ru/app638461_73337087.
  • : : www.vk.com/id146937219.
  • : 23.09.1954 .., : , , , , , 4, : 968, , 3612, 358919, 81083, 81083, 98813, 1973 ..
  • : 28.6 .., : , : rastishka, : .....................................!!!!!!!!!!!, ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ------------------------ ----------------------------------- ----------------------------, ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ------------------------ ----------------------------------- ----------------------------, --------------------------, - .., : ......, ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ------------------------ ----------------------------------- ----------------------------, , ))), ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ------------------------ ----------------------------------- ----------------------------, ----------------------------------- -----, : , , ....................., ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ------------------------ ----------------------------------- ----------------------------, ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ------------------------ ----------------------------------- ----------------------------, ----------------------------------- -&,, : www.ok.ru+ , : 2, , , ...............................----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ------------------------ ----------------------------------- ----------------------------, , ))), ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ------------------------ ----------------------------------- ----------------------------, ---------------------------------`, : ))))))))))))))))))))))))))))))))))))))))----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ------------------------ ----------------------------------- ----------------------------, ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ----------------------------------- ------------------------ ----------------------------------- ----------------------------, ----------------------------------, id : 27788941, : , !)))))))))))), , : antibk4.0v.
  • : 16.01.1967 .., : . -, -, ., 9, .: (812) 5804472.
  • : 31.08.1948 .., : "", : ., . .2
  • : 31.8 .., : www.ok.ru+ , id : 73136364,
  • : : , , , , 130, : 21061, 8860, 1983 .., 2106.
  • : 16.7.1983 .., : www.ok.ru+ , id : 27756153,
  • : - .., : www.ok.ru+ , id : 73703316,
  • : 05.07.1998 .., . , . .52 .2
  • Sadg Dasfg: : www.ok.ru+Sadg Dasfg, id : 73733338,
  • : : 1904023135, 17.02.1952 .., ² - .., : , ²
  • : : www.vk.com/id220005271.
  • : 28.8 .., - .., : www.vk.com/id146591866.
  • : 07.05.1964 .., : :
  • ..: - " ". : 144-17-24. : 835000 . - " ". : 834900 . - "-". : 840000 .
  • : : 1148010075, 07.06.1931 .., - .., : ,
  • : : 3138414499, 04.12.1985 .., - .., : ,
  • Vladlen: : www.ok.ru+ Vladlen, id : 73758547,
  • ò : : 3158017319, 18.06.1986 .., - .., : ,
  • : 17.4.1981 .., : WHITE_HOMER, : www.ok.ru+ , id : 3284291,
  • : : www.vk.com/id220927491.
  • : 22.11.1983 .., : ., -, . , . 69
  • : 27.11.1934 .., : --, , 27
  • : : www.vk.com/id220737124.
  • : : www.vk.com/id146877288.
  • : 081062 .., : ., .263, : 21099, 72364, 1995 .., : XTA210990T1817016.
  • : 06.09.1946 .., : , . .3
  • : .: 89159650800, : www.ok.ru+ , id : 73732231,
  • : 28.3 .., : www.vk.com/id146572879.
  • : : www.vk.com/id220826708.
  • : 10.08.1938 .., : -412, , 182, 59, XTK4120K0120161, 6486227, K0120161, K0120161, 1989 .., : , , 75
  • : 17.11.1918 .., : ., . -, 21
  • : 04.01.1987 .., : , ., . 25
  • : : www.ok.ru+ , id : 27988861,
  • : 21.11.2000 .., - .., .: 9287777777, : www.vk.com/id220890603.
  • : 1936 .., : ., , c, , 4
  • : 16.04.1974 .., : , . .21 .1
  • : .: 89261822760 - . (), . . . (, , 2002, , , 2002 . 10 000 - 14 999 , 2.3 , , , , : 160000 .), : , .
  • : 1932 .., . - - ..
  • : 01.07.1964 .., : , - , , , 3, : 5320, 934, 1991 .., : 780336, 1411125
  • : : 3093019679, 06.09.1984 .., - - .., : , -
  • : 04.01.1945 .., : 810310, 566702, , 1992 .., : S, 980689, /, 145688, .: 23065, : , , , 4.
  • : 24.10.1978 .., : ., . -, 10
  • : .: 89257925808 - : : , , : Holga : Canon : : 60 : , SLR : Digital, : Canon EOS : F / 8 : : Canon MPN: HOLGAHLC60F8.0CANON ( , , , : , : 1500 .), :
  • : 21.08.1962 .., H . H - .., : , , 67.
  • : 20.2.1983 .., : www.vk.com/id146588668.
  • : : 1087746847462, "- " 7713658010 1087746847462
  • : : www.ok.ru+ , id : 27846833,
  • "" ( ""): .: 17.11.2007 ., : 7113004930, : 1037102380700, : 711301001, : 70220501000, : , : 301840, , -, , , 28.
  • : : , . . 16, . (495) 4125725.
  • : 14.01.1917 .., . , . .10 .2
  • : 26.06.1926 .., : , .92
  • : 28.01.1998 .., : , . .48 .48
  • Iiyuiky Y6uiy6i: : www.ok.ru+Iiyuiky Y6uiy6i, id : 73236739,
  • : 28.10.1982 .. : . : " "
  • : 11.04.1990 .., : ., . -, 31
  • : 30.09.1925 .., : , . . 23 . 2, .: (495) 3534940
  • : : , 4.
  • : : www.ok.ru+ , id : 73735700,
  • : .: 8 (921) 9610460, 1445416, 2720898, : -, . 43
  • RUGAO City RUCHENG YUXU Stainless steel Decoration Service dept.: : QIN,FENG, : stainless steel products decoration, : , 226500, Jiangsu, Nantong, LUYUANNAN CESHINEI, .: (513) 7715640.
  • : 10.9.1996 .., - - .., .: +7914749**39, : www.vk.com/id220468077.
  • : 04.02.1979 .., : , , , , 25. : " -", : , 13.
  • : 15.03.1979 .., : , . .53/1
  • ..: : , , 3, .: 8 (846) 9522628.
  • : - " ". : ., , , 76 715. : 22-51-74, 22-51-74. : 850000 .
  • : : 20 , : www.ok.ru+ , id : 73575831,
  • : 15.05.1982 .., : ., . -, 31
  • : 6.6.1990 .., : www.vk.com/id220192576.
  • : 13.07.1950 .., .., : 425032 - . . . 71, : 1216003140,
  • : 24.3 .., : www.ok.ru+ , id : 3219296,
  • Krivushchnko Sergey: 23.8 .., : , : (12), : , - .., : , .: , : , : www.ok.ru+Krivushchnko Sergey, : , : , id : 73346088, : , : ,f.,f.
  • : : www.vk.com/id220432711.
  • : 21.06.1925 .., : ., , , .5
  • : 29.04.1948 .., : , . . 15 . 3, .: (495) 3025970
  • Xoja Jalol: : www.vk.com/id220620626.
  • - : ' ', : , 010000 . .. - . 51, .: 238278.
  • : 06.06.1967 .., - . - - - ..
  • : 10.12.1989 .., : www.ok.ru+ , id : 3296057,
  • : 9.10.1989 .., : www.vk.com/id220971241.
  • : 01.01.1946 .., . (495) 4657512.
  • : 3.4 .., .: 8965-934-59-61, : lianchik1998, : www.vk.com/id220428722.
  • : 15.5.1986 .., - - .., .: , : www.vk.com/id220427725.
  • : : www.vk.com/id220271821.
  • : 14.8.1998 .., : www.vk.com/id221057836.
  • Fdsfdsf Dsfsdfsd: : www.ok.ru+Fdsfdsf Dsfsdfsd, id : 73392532,
  • : : www.ok.ru+ , id : 73798683,
  • : 26.01.1994 .., : ,
  • : 19.06.1939 .., : , 50
  • : 16.10.1998 .., . - .., : www.vk.com/id146801687.
  • : .: 8 9242858475, : , ; , 53
  • : 16.3 .., : www.vk.com/id220624468.
  • Roman Denis: 1.4.1992 .., : www.vk.com/id220252703.
  • : 01.01.1942 .., : , . .29
  • : : www.vk.com/id220138150.
  • : 03.05.1958 .., : , , , 21. : ,
  • : 30.12.1951 .., : ., . , : 4502, 31047, 1980 .., : 131-076277.
  • : 08.03.1922 .., . , . .8 .1
  • : .: 8 (921) 3560156, 3431304, 3431304
  • Seumeren-van der Horst E M J: .: 651095601, : , , 3723EM, Bilthoven, Vermeerlaan, 27.
  • : 08.01.1921 .., : ., . -, 12
  • : 28.6 .., - .., : www.vk.com/id220376289.
  • : 18.3 .., - .., : , : , : www.ok.ru+ , : , id : 73236433, : ,
  • : 09.06.1938 .., : , .
  • : : , . . 96 . 4, . (495) 3351827.
  • : : www.ok.ru+ , id : 73875306,
  • : : www.vk.com/id220681219.
  • : 10.02.1925 .., : , , -.
  • : .: 89144767555 (), : . (.), . 16
  • : 13.09.1960 .., : 620102, , . , . , . 18, . 0, /.: 620042, , . , . , . 105, . 0, .: 83433326832, 89041670554, : .. (:620000, , . , . , . 65, . 0, ) :-
  • : : www.ok.ru+ , id : 73239021,
  • : .: 8 9502834538, : , , 21
  • ..: : , , 44, .: 8 (846) 2686474.
  • Gergr Grvew: : www.ok.ru+Gergr Grvew, id : 73438242,
  • ˲: : 2573619812, 18.06.1970 .., Ͳ - .., : , Ͳ
  • : : www.vk.com/id220217440.
  • : 14.4.1988 .., : www.ok.ru+ , id : 73414224,
  • : 03.03.1930 .., : , .
  • : : , 4.
  • : 15.11.1946 .., : , .
  • ..: : . , .: 8 (4852) 434845
  • ²в: 15.10.1973 .., : , - 5640900000, , 4, : DAIMLER-BENZ, 123D, 41181, 1978 .., : 12312010006662.
  • : 01.01.1977 .., : . , , , 6/1.
  • : : www.vk.com/id221034424.
  • : : 3089324192, 31.07.1984 .., ˲ղ - .., : , ˲ղ
  • : 2.2.1991 .., .: 89640290390, : www.vk.com/id146599488.
  • : 14.10.1919 .., : , . . 18 . 3, .: (495) 4786895
  • : 1.3.1985 .., .: 920-23-51, : www.vk.com/id146486184.
  • : : www.vk.com/id146585429.
  • : 13.06.1963 .., . , - . .7 .2
  • Nik Alex: : www.vk.com/id146929182.
  • : M B Mills, 7420, Office & Administration, Civil Engineers, : , , Harston, Haslingfield Road, Cambridge, Cambridgeshire, Eastern, CB2 5NU, CB2 5NU, Eastern, Cambridgeshire, Cambridge, .: 441223872071, : Mr M B Mills (Proprietor)
  • : 20.9.1978 .., - .., : www.vk.com/id146598404.
  • : 30.12.1960 .., : , . .508
  • Gavrihcenko Andrei: : www.ok.ru+Gavrihcenko Andrei, id : 73589317,
  • : .: 8 9038731523, : 305007 . . 10
  • : 07.02.1985 .., : , 3- . . 27, .: (495) 1765665
  • : : www.vk.com/id220033123.
  • Cociurca Andrei: 21.10.1996 .., Berestea the best - .., : www.vk.com/id220372180.
  • : : www.vk.com/id221146739.
  • .. ., - 19 8 (2000.02.01 ): .: 8 (473) 26651480
  • Wahdan Ahmed: : www.vk.com/id220835021.
  • : : www.ok.ru+ , id : 3171154,
  • : : www.vk.com/id220133335.
  • : 12.07.1994 .., : , . .19 .
  • : 24.02.1954 .., : , , .
  • : 968, (), , , ,, 1984 .., : , :
  • : 9.8.1989 .., - .., : www.vk.com/id221152432.
  • WUJIANG QIDU HAOHUA Furniture Factory: : ZHANG,YUNJIANG, : woodfurniture, : , 215234, Jiangsu, Suzhou, XINTIANWAN, QIDU Town.
  • : 28.11.1924 .., : , - 5940200000, Ͳ, 116, : , 1102, 60715, 2003 .., : Y6D11020730383783.
  • : 08.11.1962 .., H .H - .., : (.: 23.10.01 H) 99, .
  • : 24.03.1972 .., : ., . - - 12, : 21083, 52778, 1998 .., : XTA210830W2373377, 21083-2461400.
  • : 09.12.1955 .., . (495) 5566794.
  • : : www.vk.com/id220603829.
  • : 6.12.1996 .., - .., : www.vk.com/id146749032.
  • : : , 6, .: 8 (383) 238957.
  • : . .: 8 9050716375, : . . 38
  • : 12.7.1984 .., - .., : www.ok.ru+ , id : 27818282,
  • : 08.11.1967 .., . , ., .3, .1.
  • Riverson Romeo: 21.10.1988 .., : www.ok.ru+Riverson Romeo, id : 3119903, : http://slc.my1.ru/.
  • "" ( )": .: 8 (4922) 363269
  • : : www.ok.ru+ , id : 73486330,
  • : 1939 .., : ., ,
  • Esenbaeva Aisaule: 27.10.1997 .., : www.vk.com/id220382258.
  • Ongarov Anes: : www.vk.com/id146916338.
  • , , : 2107, 0374335, 1200, 1988 ..
  • : 17.03.1968 .., : ., , , 1.
  • : 17.5.1986 .., : www.ok.ru+ , id : 28042707,
  • : , . . 10/12 . 6 ,
  • : 27.03.1979 .., : . - . : , 42.
  • : : www.ok.ru+ , id : 73278401,
  • : : ""
  • : 27.8 .., : www.vk.com/id220955569.
  • Moss Trey: : www.ok.ru+Moss Trey, id : 73464170,
  • : .: 8 9241049204, : , --;, 34
  • : 22.4.1988 .., : www.ok.ru+ , id : 27963637, : http://vk.com/app3745135_27963637.
  • : 4.12.1998 .., : www.ok.ru+ , id : 73708860, : http://vkontakte.ru/.
  • : : www.ok.ru+ , id : 73072342,
  • : 4.7 .., : www.ok.ru+ , id : 27769998,
  • : 31.01.1973 .., : 443096, , , , , 48, : , , -, 72763 *, 9L21230030020384, 0020384, 0005786, 2003 ..
  • : : 3, 2263, 1976 .., : 060864, 060864, : , .
  • : : www.ok.ru+ , id : 73097932,
  • ?Yano4ka?: : , : jana-garabazhiu@rambler.ru
  • Dasdas Asdasda: : www.ok.ru+Dasdas Asdasda, id : 73479847,
  • : : , , 8, 22, .: 8 (3902) 25020.
  • : 14.05.1966 .., : . , : " " 5201000024, : , .
  • Sokolov Wadya: : www.ok.ru+Sokolov Wadya, id : 73487120,
  • : 03.03.1982 .., : , . .16 .3
  • "" - "": ,
  • : 27.09.1968.., : , , ., 44. : --
  • : 28.01.1969 .., . , - . .18
  • : : www.vk.com/id220241054.
  • : 1.8.2000 .., - .., : www.ok.ru+ , id : 27899451,
  • : .: 8 4235656186, : , ,,0, 17
  • : 5.12 .., - .., .: 09, : www.vk.com/id221079594.
  • : 26.01.1946 .., : ., ., , 22
  • : 14.05.1976 .., : 443076, , , , , 8, : 161109, , , 941163, VF1J038615144, VF1J038615144, D027281, 2007 ..
  • ( .): 25.06.1964 ..
  • .. 231689: .: 1251534, : , , 13 - .3
  • : .: 8 (921) 9956318, 827025895, 827025895, : , 23
  • : : www.vk.com/id220594312.
  • --- : : www.vk.com/id220740319.
  • : 04.10.2000 .., :
  • : : www.vk.com/id146498323.
  • : 25.2 .., .: 89201587938, : www.ok.ru+ , id : 73208762,
  • : 27.01.1964 .., H - .., : , , 6 15.06.01.
  • : , . . 34 ,
  • : 25.10.1970 .., : /
  • : : , . .2
  • : : www.ok.ru+ , id : 3062289,
  • : 09.07.1974 .., : , , - -.
  • Nowohatskaia Natali: - .., : www.vk.com/id146878574.
  • : 28.04.1994 .., , . - .., : 5 3.
  • : .: 89601336849 (), : ., 397550, . , . , .1
  • : .: 8 3952423848 (8 3952 423848), : , , , 333
  • " " - " ": , : 1000000 ., ./: 2-96-32, 2-96-32, : - , : 4707015383, : 46283368, : , : 188480, 188480, 2-96-32.
  • : 18.2 .., - .., : www.ok.ru+ , id : 27717569, : http://vkontakte.ru/club4615894.
  • ò: : 3069220318, 12.01.1984 .., - .., : , .
  • : 21.11.1964 .., : , .
  • " " - " ": , .: 03.12.2002 ., : 840000 ., ./: 554-09-24, : - , : 7825693239, : 48991744, : , : 191040, 000000.
  • Karimova Kristina: : www.ok.ru+Karimova Kristina, id : 73820223,
  • Whittlermrs Whittlermrs: : www.ok.ru+Whittlermrs Whittlermrs, id : 73595339,
  • Kondryuk Serhiy: 16.5.1992 .., : www.ok.ru+Kondryuk Serhiy, id : 27846217, : http://vkontakte.ru/id27846217.
  • Rijn D W: .: 714014480, : , , 2225KC, Katwijk zh, Willy Sluiterstraat, 9.
  • : 4.3 .., : www.ok.ru+ , id : 73335664,
  • - : : www.vk.com/id221019732.
  • : 17.04.2001 .., . , . .81 .3
  • : 22.11.70 .., : , , . , ., 255. : "", 456620,
  • : 6.12.1991 .., : www.vk.com/id146633431.
  • : 20.08.1960 .., : , . . 5 . . 5, .: (495) 2594726
  • : 6.2.1980 .., .: +79516752646, : www.vk.com/id146519410.
  • Ewt Drt: : www.ok.ru+Ewt Drt, id : 3137852,
  • : 16.06.1974 .., : ., . - - 62, .: 8 (812) 2253164, : , 43278, 1993 .., : WVWZZZ1ZR170327, D257766.
  • : : www.ok.ru+ , id : 73419004,
  • : 01.10.1927 .., : , , , 62
  • : 3.4 .., - .., : www.vk.com/id221121112.
  • : : 3036521232, 19.02.1983 .., - .., : ,
  • Ͳ : : 3173810819, 23.11.1986 .., ʲ - .., : , ʲ
  • : 05.09.1957 .., : . -, -, ., 10, .: (812) 1575104.
  • : 18.02.1955 .., . , . .25
  • : 25.1.1991 .., : , : Counter-Strike, Call of Duty , GTA 4, World of Tanks, - .., : , .: Samsung Galaxy Gio, : , 1 2 3, , , : punk0009, : www.ok.ru+ , : , , , : Punk rock, ska punk (, Linkin park, AFI, lit, , , , Anti flag, New Raid, Clockwork Times, Mad Heads XL, Limp bizkit ), id : 27906289, : , : http://www.ex.ua/.
  • : 11.12.1947 .., . - - ..
  • : 5.10.1991 .., : www.vk.com/id220763007.
  • : 04.05.1967 .., : ., . , 5 . 66
  • : 09.03.1936 .., : ., , , 46.
  • : 230962 .., : ., , : 2103, 640862, 1981 ..,
  • : : , . .10
  • : : , . . 6, . (495) 7006692.
  • : : www.vk.com/id220266780.
  • : 19.04.1964 .., : 31121, 0882, , 1986 .., : 254106, : , .
  • : 04.09.1974 .., :
  • ʲ: : 1842822491, 15.06.1950 .., - .., : ,
  • : 20.05.1973 .., : , - 5640100000, II, 16, : FIAT, DUCATO, 05018, 1985 .., : 0.
  • : 7.9.1975 .., .: 8902 87, : www.ok.ru+ , id : 73275728, : @ru.
  • : 14.02.1971 .., : , - 5625055100, ., ., : , 5312, 28513, 1989 .., : 0, 1226114.
  • : - .., : www.vk.com/id220723053.
  • : .: 8-921-5402392 (), : ., , 55
  • : .: 8-921-2512809 (), 8202211046, : ., , , 23
  • : 28.3 .., : (C), C- - .., : www.ok.ru+ , id : 3272803,
  • : 21051964 .., - .., : . . .10 .5
  • : 27.10.1994 .., : www.ok.ru+ , id : 73614238, : http://vkontakte.ru/app638461_73614238.
  • : : , .1121 .0
  • : : www.vk.com/id220914506.
  • : 25.01.1950 .., :
  • : : , ., ., .19.
  • : 05.12.1975 .., : --, 37
  • : 11.10.1967 .., : ., --, , 17.
  • : 12.4.1991 .., : ....., : 2101, : ., - .., : .., : ., : www.ok.ru+ , : .... ., : ... .... ......... ., id : 27913195, : ....=)) !!, : www.kar.ru.
  • ..: : , . 58 . 2 ,
  • : : www.ok.ru+ , id : 27768126,
  • : 11.07.1962 .., : 8103, 3557, , 1985 .., : 390365,
  • : 19.08.1975 .., : ., . -, 15
  • : , - .., : www.vk.com/id146531452.
  • : : www.vk.com/id220413672.
  • : : www.ok.ru+ , id : 73197961,
  • : 13.02.1977 ..
  • : 27.4.1994 .., - .., .: 89613490192, : 5555, : www.vk.com/id220622432.
  • : 02.01.1961 .., : , . .2
  • : : , . 118 . 2, . (495) 1822268.
  • : 28.05.1954 .., , . . 4 . 2, . (495) 2168541.
  • : : www.vk.com/id220449383.
  • ..: , . . 8 . . 8 ,
  • : 21.11.1999 .., - .., .: 89639403587, : www.vk.com/id220357706.
  • : 01.10.1981 .., : . -, -, ., 34
  • . .: : , , , 128, .: (86/) 236232.
  • : 21.4.1988 .., : www.ok.ru+ , id : 3125840,
  • YIXING City JIANGYUAN Industrial chemicals Co.,ltd.: : WANG,YAOHUI, : 1730,1741 polyester , , , wholesale retail, : , 214200, Jiangsu, Wuxi, ZHANGSHIQIAO BEITU, YICHENG Town, .: (510) 7913076.
  • : 25.09.1943 .., . , . .33
  • : 25.2.1994 .., : www.vk.com/id146754361.
  • Zhangjiagang Free Trade Zone ZHONGGONG International Trading Co.,ltd.: : ZHAO,JIONGXIA, : , 215634, Jiangsu, Suzhou, HONGFA Masion, Free Trade Zone.
  • : : --> , : - .
  • : 6.4.1993 .., : www.vk.com/id146528009.
  • : 30.07.1972 .., : , 3- . . 6 3- . . 6, .: (495) 1592446
  • Saad Houssem: 28.9.1983 .., : www.vk.com/id220995492.
  • : 08.07.1983 ..
  • " " - " ": , : 840000 ., : - , : 0, : 48976650, : , : 193167, 193167.
  • , , : , 329423, 9747, 1973 ..
  • : .: 8 (3812) 942459, : , / 204 13.
  • Semapala W: : -, VG, 40/1/1 Pattigoda Veyangoda
  • : - .., : , - 6 . 16 68,
  • : 22.12 .., : www.vk.com/id146650866.
  • : 5.2 .., : , : www.ok.ru+ , id : 27980399,
  • : : www.ok.ru+ , id : 73357542,
  • Morrissey Menippus: : www.vk.com/id220446003.
  • : 13.11.1953 .., : , - 5940200000, .., 1, : , 968, 3976, 1984 .., : 0.
  • : 4.10 .., - .., .: :)*, : www.vk.com/id220925769.
  • ˸: : www.vk.com/id220401539.
  • : 10.07.1934 .., : , , , 68.
  • King Marco: 18.11.1986 .., : www.vk.com/id220399063.
  • : : www.ok.ru+ , id : 73246626,
  • : 01.01.1955 .., : , .63, : 20.01.2007
  • : : 1067746257150, "" 7724568104 1067746257150 ; "" 7724568104 1067746257150
  • Kaaphoofd Huisartsenpraktijk: : -, 1784AT, Den Helder, Marsdiepstraat, 210, .: 223681366.
  • : - .., : www.vk.com/id221091036.
  • : 15.01.1966 .., : , - 5624683301, , 16, : MERCEDES-BENZ, E 200, 00203, 1995 .., : WDB1241201J072743.
  • : 2.7.1994 .., : www.vk.com/id220345555.
  • : 01.05.1937 .., : , .27 .5
  • : .: 8 9065759223, : 307910 . . 28
  • : TOYOTA CARINA, (), , , , 259604, 1993 .., : , :
  • : : www.vk.com/id220144017.
  • : 05.05.1966 .., : , , -.
  • Kjgk Iu6yrtu: .: ................., : www.ok.ru+Kjgk Iu6yrtu, id : 73349892, : ................
  • : .: 8 9046252995, : , , 3
  • Sinclair Ravyn: : www.vk.com/id221096789.
  • : : www.vk.com/id146537322.
  • : , . . 47 . 3 ,
  • в : : 2637421796, 17.03.1972 .., - .., : ,
  • : .: 8-921-5333983 (), : ., . . , 16
  • @. @: : www.ok.ru+@. @, id : 73251196,
  • : 08.10.1992 .., : --, 339 , 23
  • : 21.07.1973 .., : , . --, ., 38. : / 52015, : , -- 31, : , .: 550127 .
  • : : 2199926054, 25.03.1960 .., Ѳ - .., : , Ѳ
  • : BARBAROSSI doo: : 1993 ., : 35000, Slavonski Brod, Andrije Hebranga D3/2, Andrije Hebranga D3/2, HR-35000 Slavonski Brod, : Mira Barbaric, dir. (Uprava) - dir., : 38535451165, : ugostiteljstvo, trgovina na veliko i malo, usluge, prodaja svih prehrambenih proizvoda, , , , , , , , , , .
  • : 26.8 .., - .., : www.ok.ru+ , id : 73564926,
  • : 18.7.1971 .., . - .., : www.ok.ru+ , id : 3070084,
  • : 17.03.1924 .., : , 3- . .25 .1
  • : 21.10.1993 .., : www.vk.com/id146814565.
  • Ѳ в : 11.11.1911 .., : , - 5624689504, , 16, : , 408, 3572, 1972 .., : 114127, 081723.
  • : 05.04.2004 .., :
  • GUANYUN County People Theatre: : ZHAO,FAQIN, : ., : , 222200, Jiangsu, Lianyungang, ZHONGDA Street, YISHAN Town, .: (518) 8805658.
  • . : : 1035007213977, "" 5036053090 1035007213977
  • : 1972 .., : . .140
  • : : , 27
  • ZHANGJIAGANG City FENGYANG Auto parts Supplying dept.: : CAI,YUXIANG, : automobile decoration service, : , 215600, Jiangsu, Suzhou, No. 18, GONGYUAN BEI Road, YANGSHE Town.
  • : 14.9.1999 .., - .., .: 8900204***4, : www.vk.com/id220124748.
  • () : : www.ok.ru+ () , id : 73101241,
  • : : www.ok.ru+ , id : 27754847,
  • : 08.03.1965 .., : , .
  • : - .., : www.vk.com/id220055790.
  • : 16.04.1985 .., : , , . .14
  • : 12.3.1987 .., - .., : www.ok.ru+ , id : 3255357,
  • : 06.01.1982 .., : , ., . . 15
  • : : www.ok.ru+ , id : 27806531,
  • : 1.1.1970 .., : www.vk.com/id220166660.
  • The Worminator: : www.vk.com/id146641154.
  • : 14.12 .., : www.vk.com/id146788232.
  • : 14.07.1986 .., : --, , 24
  • : : www.ok.ru+ , id : 73729692,
  • : : 2538519112, 02.07.1969 .., - .., : ,
  • : 23.08.1959 .., : 652780, , -, , , 4
  • : 09.04.1943 .., : ., .3
  • * *: : , , ., 2, : 21112, 759177, 2006 .., : XTA21112070256848.
  • : 22.07.1997 .., : , , , 16
  • ( .): 22.10.1981 .., - ..
  • Taganashvili Barbara: : www.ok.ru+Taganashvili Barbara, id : 73702075,
  • : 03.09.1937 .., : , , , 89
  • : 03.09.1954 .., : , , , 139
  • ²˲ : : 3095519778, 01.10.1984 .., - - .., : , -
  • : : ., . -, 25
  • : 3.11211, (), , , ,, 1986 .., : , :
  • ", " .. (" " ..(3)2518): .: 10.10.2006 ., : 7707012620, : 5067746989426, : 770701090, : .2 .21.1 08.08.2001 129-, : 123592, .
  • : 01.01.1967 - .., : , ., 19044013, -2, 654, : 4310, , D813KZM, .., 1990 ..
  • : 2.9.1989 .., : kirillshurygin1989, : !!!!, - .., : , !!!, : !, : www.ok.ru+ , : !, : !, id : 73257533, : !, : .
  • : TOYOTA ESTIMA, (), , , , 259396, 1993 .., : , :
  • : 03.01.1956 .., : , , ( -).
  • Mika ******************mihaela*******: : www.vk.com/id146885828.
  • : 08.10.1966 .., . , . .79
  • : 11.03.1983 .., : PEUGEOT 308, , 147152, Z8T4C5FS0BM013530, 2011 .., : , . 66 74
  • : 12.8.1943 .., - .., : www.vk.com/id220401228.
  • : : www.vk.com/id220067116.
  • : - .., .: 89536257937, : www.vk.com/id146869515.
  • : : , , 34, .: (8) 9106627976.
  • Salander Elisabet: 22.11.1980 .., : www.vk.com/id219977023.
  • : 14.11.1954 .., :
  • : : www.vk.com/id146854192.
  • : 27.08.1968 .., :
  • : 15.10.1986 .., : , .13 .1
  • 06.04.1961 ..: : ., . - .3
  • Ygyyytyty Yyuyiuyuiy: : www.ok.ru+Ygyyytyty Yyuyiuyuiy, id : 73792793,
  • : 28.05.1969 .., : , 15
  • : : www.vk.com/id146772450.
  • : 04.12.1953 ..,
  • : 27.09.1969 .., : ., , . , , .2
  • : 17.03.1947 .., - . - - ..
  • : 1.7 .., : www.ok.ru+ , id : 73739076,
  • : : 3246508779, 19.11.1988 .., - .., : ,
  • : 22.10.1976 .., , . . 23, . (495) 3399937.
  • : 29.10.1958 .., . , . .23 .1
  • ³: : www.ok.ru+ ³, id : 27724905,
  • Farishta Farishta: : www.vk.com/id220042646.
  • : 11.11.1911 .., : , - 5640900000, , 2, : , 11027, 7359, 1995 .., : XTE1102070S0319166, 308482.
  • : 06.10.1969 .., : , , , 10. : " -", : , 13.
  • Sanders Fred: : it',s always darkest, just before it turns pitch black and you',re eaten alive by vampire sheep., : chess, : upanishads, : malcolm x, : www.ok.ru+Sanders Fred, : columbo, : mozart, id : 73640379, : quantum physics,
  • : 14.3 .., : www.ok.ru+ , id : 73322323,
  • DANYANG City CHENYI Chemcial plant: : SUN,YIJUN, : peroxidized methyl ethyl ketone, : , 212361, Jiangsu, Zhenjiang, HOUZHUANG Village, DAOSHI Town.
  • .): .: 15.12.2005 ., : 4214016284, : 1034200009315, : 421401001, : 32425000000, : , : 652870, , -, , , 3.
  • Azakov Fuad: 5.6.1988 .., .: ***777-14-8*, : www.vk.com/id220163454.
  • : : www.vk.com/id221194319.
  • Xachatryan Mariam: : www.vk.com/id220815022.
  • : : www.vk.com/id221168736.
  • Aleksey Ponkratov: : poncratovleha@mail.ru
  • : .: 8 (812) 700196, .: 7267325 (Tele2), : , , - 7
  • Kopaniova Petra: 30.1.1987 .., : www.vk.com/id220367446.
  • : 27.03.1965 .., : , . .26 .2
  • : : , . .6 .2
  • STRASSENVOGEL WAREN GMBH - , : 18196 , PETSCHOW 1, TESSINER STRASSE, : "", : 119019, , , . ., . 22, . 2, . 11, : - 7-931-318-60, : , ( ), , , .. : 810 , : 1024 GDDR3 1000 - MICRO-STAR INTERNATIONAL, MSI
  • Gaga Lady: : www.ok.ru+Gaga Lady, id : 27847685,
  • : 17.12.1934 .., : , . .14 .4
  • : : www.vk.com/id220163834.
  • : 08.02.1974 .., : _!: , ., -, .
  • : 25.01.1917 .., : , . .16
  • : 04/18/60 .., : ., . , ( , 8
  • : 1974 .., : ., , , , 36/3
  • : , .3 . : : , : 03.02.1995, : 2, :
  • - (-): .: 22.10.2006 ., : 7711028461, : 1067758461176, : 774301050, : .2 .21.1 08.08.2001 129-, : 101000, , 5-29 .
  • : 25.12 .., : www.vk.com/id221032205.
  • + +: : www.vk.com/id220699423.
  • : 23.12.1949 .., : ., , , .9
  • : .: +79275591190, +78512316011, : 416426, , -, ,
  • SUZHOU City XINGUANG Hardware Factory: : TAO,XINGMEI, : metal-cutting pieces, : , 215008, Jiangsu, Suzhou, ERZU, CHAHUA Village, HUQIU Town, .: 0512-66281235.
  • : 07.01.1989 .., : , . .11 .3
  • : 24.07.1988 .., : (), . , 20
  • : 14.06.1963 .., - ..
  • : 21.07.1985 .., : , , /,
  • : : ., . . .9
  • : 17.10.1973 ..
  • : 07.01.1960 .., : 21099, 28902, , 1994 .., : 210990S1601705, 1601705, 1619426, : , , , 24.
  • : 14.01.1927 .., : ., . -, 3
  • : 29.9 .., : www.ok.ru+ , id : 73369630, : http://mystena.ru/id_jannka.
  • SIERRA Sanchez ORLANDO L: .: 8702341, : , AYUNTAMIENTO # 202 04 APTO.6 LOMBILLO Y 1RA
  • : 01.06.2001 .., . , . .73 .1
  • : : www.ok.ru+ , id : 73680207,
  • Dhdfg Hsdhdfh: : www.ok.ru+Dhdfg Hsdhdfh, id : 73237928,
  • : 01.01.1967 .., : , , , 21
  • : 20.4 .., - .., .: +7917758**11, : psaiker17, : www.vk.com/id146527849.
  • : 27.09.72 .., : , , -., 32, 45. : " ", 454038, . , -
  • : .: 8 9243260402, : , ;, 15
  • : 02.07.1968 .., : , .21
  • Maga Morpho: : www.ok.ru+Maga Morpho, id : 73286724,
  • : 1948 .., : 34. :
  • : : , 2.
  • Segboer A J: .: 246963930, : , , 6586AT, Plasmolen, Broekweg, 8.
  • '': : , - 5640100000, , 120, : , 55111, 8145, 1991 .., : 0, 0068202.
  • - : 19.10.1990 .., : www.vk.com/id146637287.
  • Cvxcvcx Dsfds: .: aaaaaaaaaaaa, : www.ok.ru+Cvxcvcx Dsfds, id : 73726801, : aaaaaaaaaa.
  • : 28.10.1935 .., : , . .17 .3
  • : 29.05.1960 .., : , , 48 65
  • : : www.ok.ru+ , id : 73511378,
  • : : www.ok.ru+ , id : 73842267,
  • : : www.vk.com/id220920094.
  • Piu Dez: 21.11.1988 .., - .., .: +79377122202, : www.ok.ru+Piu Dez, id : 73500900,
  • : : www.vk.com/id219976796.
  • : 21.01.1958 .., : , , ., 23
  • : : ,
  • : 23.10.1980 .., : www.vk.com/id220392391.
  • Co Sophie: : www.ok.ru+Co Sophie, id : 3119030,
  • Voikov Vadim: : www.vk.com/id220979598.
  • : AB Kvarnbyfoder: : Head Office, : 1928 ., : SE SE-245 21 Box 84 Staffanstorp, Traversv 4 SE 24534 Staffanstorp Sweden, : Gert Ekelund - Managing Director, : 4646250371, : Manufacturers : 45 : 12521914 EUR : 360000 (SEK) : Svenska Handelsbanken.
  • Mullayeva Lera: 1.3 .., - .., : www.ok.ru+Mullayeva Lera, : mullayeva, id : 27787780,
  • : : , : , Assassin',s Creed, , FIFA09, , Stronghold 3 - Legends, - .., : , : 1, 2, 3, 1, 2,, : www.ok.ru+ , : Russia, : , , , , , id : 27830661, : , , : , .
  • : TOYOTA VISTA, (), , , , 259420, 1997 .., : , :
  • 28.04.2003 ..: : ., . 1 .7
  • : 23.11.1973 .., , . . 25, . (495) 9494182.
  • : 16.11.1979 .., : ., . -, 19
  • : 17.6.1986 .., : www.ok.ru+ , id : 3288410,
  • : : 2247524610, 14.07.1961 .., ˲ - .., : , ˲
  • : . .: 8 9609107103, : . . 13
  • : : !, : www.ok.ru+ , : Disturbed, , , Rammstein, , , Drowning Pool, , , System of Down, , , , , , KON, , , Static-X, , , In Extremo, , , , id : 27750612,
  • : : www.ok.ru+ , id : 3265697,
  • : 05.09.1977 .., : ., , , 26.
  • : 10.10.1991 .., : www.ok.ru+ , id : 27833040,
  • : 21.04.1990 .., : , 452308
  • : : , , 09.01.1949 .. / .15
  • : 14.07.1987 .., . - . - .., : . .
  • : 15.07.1976 .., : , 1- . .16/26 .6
  • : 28.11.1966 .., , . - .., : 60 12 11.
  • Ѳ Ѳ: : 2695219413, 16.10.1973 .., ʲ - .., : , ʲ
  • : 12.08.1997 .., : , ., , 4
  • SERGEEVA LIUBOV: : AYT --> , : 5.
  • Wowa Wowa: : www.ok.ru+Wowa Wowa, id : 73859448,
  • : 28.07.1982 .., : , .
  • : : www.vk.com/id146729015.
  • : 2.6 .., - .., : www.vk.com/id146654295.
  • : 12.11.1968 .., : , , , 10
  • : 15.11.1943 .., : , .
  • : 20.08.1974 .., : , . .3 .2
  • : : www.vk.com/id220704571.
  • : 08.08.1946 .., : 2, 1952, , 1977 .., : 1428, 3388, : , , 62.
  • : 05.06.1961 .., , . . 12, . (495) 1734897.
  • Atmaca Metim: : www.vk.com/id221193761.
  • "" 7725608744 5077746890249: ./: 9544826, 0, : 115191, , , 6, 111.
  • ² : : 2574321074, 25.06.1970 .., ʲ - .., : , ʲ
  • Vukovich Katarina: 23.10.1991 .., - .., : www.vk.com/id220115701.
  • H ( .): 10.05.1984 .., - ..
  • : 06.10.1959 .., : ., --, , 5.
  • : 29.08.1962 .., . - . - .., : . . 53
  • : 30.07.1974 .., : , .
  • : 1989 .., . - ..
  • : .: 3809, : www.vk.com/id220109463.
  • : 01.01.1900 .., : , - 5941000000, , 4, : , 2101, 2412, 1978 .., : 2829674.
  • : 17.05.1986 .., : , , , 10
  • : The Trust Co (GB) Ltd, 6713, Head Office, Financial Services, : , , 12 Billing Road, Northampton, Northamptonshire, East Midlands, NN1 5AW, NN1 5AW, East Midlands, Northamptonshire, Northampton, .: 441604632400, : Mr M Hogann (Director)
  • : 11.11.1911 .., : , - 5640100000, , 35, : , 11027, 2854, 1994 .., : TE110270P0267920.
  • : : www.ok.ru+ , id : 3167780,
  • Yaxyayev Jaxongir: 29.1.1995 .., .: +79531726998, : www.vk.com/id220891369.
  • : : .shy., : www.ok.ru+ , id : 73613663,
  • Wefe Wefewf: : efe, : effef, : fefe, : www.ok.ru+Wefe Wefewf, : fefef, : ewfewf, id : 73798469, : ewfewfew,
  • : : www.vk.com/id221181167.
  • : : www.ok.ru+ , id : 27797477,
  • : : 1525413277, 06.10.1941 .., Ϊ - .., : , Ϊ
  • , : , . , .
  • : : , . 1, .: 8 (495) 5945278.
  • : SSANG YONG ISTANA, (), 5 , , , 06825, 2000 .., : , :
  • "" - "": , .: 13.01.2003 ., : 840000 ., ./: 327-34-30, 327-34-30, : - , : 7814101096, : 50891211, : , : 199226, 199226, 327-34-30.
  • : 13.03.1939 .., : (), . , 21
  • : : www.vk.com/id220761547.
  • : 5.5.1985 .., - .., : www.ok.ru+ , id : 3290435,
  • : 10.7.1981 .., : www.ok.ru+ , id : 27929510,
  • : : www.ok.ru+ , id : 73072873,
  • : : , .147 .2
  • "-" ( "-"): .: 04.04.2013 ., : 5401173000, : 1025400513600, : 540101001, : 50401364000, : .2 .21.1 08.08.2001 129-, : 630124, , , , 01.08.2013.
  • : : www.vk.com/id220097245.
  • : .: 8 9025538449, : , , , 111
  • : 02.11.1966 .., : , . .8
  • Kaplinskii Semen: : www.vk.com/id220265669.
  • : 02.04.1977 .., : , . . 6, .: (495) 3010206
  • : - - .., : www.vk.com/id220979601.
  • : 30.05.1964 .., : ., -, , . 28
  • ò: : 935814534, 15.08.1925 .., ʲ - .., : , ʲ
  • : Cbc Assurances: : , 5600, Philippeville, Rue De Givet.13, .: 3271666816, : General Insurance Agents.
  • : : www.vk.com/id220523887.
  • : : www.ok.ru+ , id : 73797427,
  • : 1940 .., : /. :
  • : 06.11.1946 .., : ., , , 16.
  • : 15.08.95 .., : , , ., 13
  • : : , 2- , .: 8 (4752) 719461.
  • в ˲: : 3426802174, 27.10.1993 .., Ҳ - .., : ,
  • : 19.7.1989 .., .: 80633348561, : www.ok.ru+ , id : 28015222,
  • : 2.11.1994 .., : - . ( ), ??-???? Nk - 20 ?????? - .., : , : , : www.ok.ru+ , : Comedy Club, id : 73539043, : , , street workout,
  • ..: : . , .: 8 (3452) 214857.
  • : 08.11.1931 .., : ., , . , , .5
  • : 28.05.1935 .., : , - .3
  • Eee Eeeeeeee: : www.ok.ru+Eee Eeeeeeee, id : 73548217,
  • : 17.11.1964 .., : 21099, 91202, --, 21083, 2000 .., : 21099012886850, 2886850, 3012052, : , , , 6.
  • : 04.01.1949 .., : , , .
  • : 02.08.1994 .., : , , 1
  • Bekmurat Tanka: 16.8.1989 .., : www.vk.com/id221128485.
  • : 21.11.1941 .., : , . .23 .1
  • : 18.04.1974 .., : .:; 15-17 :
  • : 9.6.1998 .., : www.vk.com/id146822301.
  • : 1.5.1987 .., - .., : www.ok.ru+ , id : 73659643,
  • , , : 2107, XTA210700X1230439, 08941, 1999 ..
  • : 10.05.1927 .., : .3 .20
  • : .: 9112179256, 8 (812) 5278276, : , -, ., .45, .1
  • : : www.vk.com/id220270397.
  • : : www.ok.ru+ , id : 73857202,
  • : 19.05.1957 .., . , . .3 .3
  • в : : 2990319899, 14.11.1981 .., - .., : , Ͳֲ
  • : : www.vk.com/id220285534.
  • : : www.ok.ru+ , id : 73586982,
  • : 17.07.1926 .., : ., . -, 5
  • : 27.6.1965 .., : , . - ., : Rumikab',, - - .., : , , , , , , : , , , , : www.ok.ru+ , : , , , , , : , id : 3084031, : , , , , , ,
  • : : www.vk.com/id220103874.
  • : : , 28.
  • : : www.ok.ru+ , id : 73457553,
  • : 17.12.1975 .., , . . 9 . 3, . (495) 1170390.
  • " .. N 5" - " N 5": , : 840000 ., ./: 274-38-53, 274-38-53, : - , : 0, : 50933375, : , ; , : 193024, 193024, 274-38-53.
  • : 23.1 .., : www.ok.ru+ , id : 73556437,
  • : 28.6.1991 .., - .., .: 89373081867, : 584604944, : www.vk.com/id146872154.
  • : 09.02.1956 .., : , ., , 6, 22
  • : : 2800421753, 02.09.1976 .., - .., : ,
  • IJ : : 1869022118, 04.03.1951 .., '-IJ - .., : , '-IJ
  • : : www.vk.com/id221126146.
  • : 30.10.1968 .., : ., .- - 30/3, : 2126-030, 37378, 2002 .., : 21260020060861, 2106 7012332.
  • : 18.11.1959 .., , . . 1 . 2, . (495) 1464457.
  • : 9.10.1991 .., .: 953-925-00-11, : www.vk.com/id220365798.
  • : : www.ok.ru+ , id : 27783890,
  • : 26.06.1981 .., : ., . , . 12
  • : 17.01.1991 .., : , . . 26, .: (495) 2126655
  • Hassanin Mohamed: Hurgada - .., : www.ok.ru+Hassanin Mohamed, id : 73709322, : sun and sea,
  • -: 04.11.1995 .., :
  • Ѳ : 06.02.1969 .., : , - 5640100000, I, 5, : TOYOTA, CAMRY, 35385, 1986 .., : TA46117880.
  • : : 6736, 6726, -, 1977 .., : 082800, 086266, : , , 17.
  • ²: : 3137113713, 21.11.1985 .., - .., : ,
  • : 19.5.1995 .., - .., : www.vk.com/id220208439.
  • : 04.08.1983 .., : , , .
  • ..: : , . . 3 ,
  • : 01.01.1900 .., : , - 5920650100, ., 47, : , 11211, 4341, 1990 .., : 0, 171851.
  • : 16.01.1990 .., : - , ., ., 7
  • : 28.07.1966 .., : ., . - - 67, : 21099, 804678, 1996 .., : XTA210990T1873858, 21083-1896226.
  • : : www.ok.ru+ , id : 73861482,
  • : : ., . -, 37
  • ? : : www.ok.ru+? , id : 27957988,
  • : .: 8 9066741875, : 394043, . , . , .31
  • : : www.ok.ru+ , id : 73354184,
  • : 1.9.1987 .., : www.ok.ru+ , id : 27820505,
  • Yildi Yilmaz: : www.vk.com/id220644898.
  • SALEH ABDULLA GROCERY : : -, (), 3229, Dubai, : 97143364259, : Grocery Store
  • Kara Hasan: 23.8.1994 .., turkey - .., : www.vk.com/id220146891.
  • : 23.05.1972 .., : , -, 33
  • : 13.8 .., : www.vk.com/id220322467.
  • : 23.03.1989 .., : , --, , ., 2.
  • : 11.02.1982 .., : , , .
  • : 12.10.1987 .., : , -
  • Kostuchenko Vlad: 13.2.1999 .., - .., : www.vk.com/id220251056.
  • : 06.10.1963 .., : , . .16 .1
  • : Ͳֲ (, ) ʲ "" (""), .: , 20383 , -, , . Ͳ, .58, .: ̲Ͳֲ, 10151200000000295, 17.01.2006 ., : 1) 26261465, Ѳ , : : 00000 IJҲ : 80.10.1 i i.
  • 08.02.1986 ..: : ., . .86
  • : NISSAN ATLAS, (), , , , 22325, 1982 .., : , :
  • ..: : , , 7, .: 8 (846) 9281703.
  • Ԩ: 09021967 .., - .., : - . . .16
  • : 01.01.1900 .., : , - 5923255100, ., 13, : , 4, 9938, 1982 .., : 793777, 125434.
  • : : www.vk.com/id220861218.
  • : .: 2210145, : , , -., -.7, .27
  • : 6.3.1999 .., .: 87051871924, : www.vk.com/id221171660.
  • : : www.ok.ru+ , id : 73432419,
  • : : www.vk.com/id220141110.
  • : 1941 .., : , .,2 ,23
  • : : 3154214152, 11.05.1986 .., - .., : ,
  • : . .: 8 9069267173, : 652470 .- . 20
  • : 23.03.1950 .., : , . .6 .1
  • : 29.10.1935 .., : , . .5
  • : 05.05.1950 .., : , . . 35 . 4, .: (495) 1124684
  • : 5.4 .., - .., : www.vk.com/id220127574.
  • : .: 89069823602 (), : 652500 .- . 17 .0
  • Teresh Gabriel: : www.vk.com/id221047393.
  • KUNMING UNITED OPTICS CORPORATION - , : 650106 KUNMING 2007 KE GAO ROAD, KUNMING NATIONAL HIGH TECH, : "", : 190005, , .-, , .22, : - 8(4822)53-61, : LEVENHUK ENERGY PLUS 8X25,() 8,.-25,. -2,. ..: - KUNMING UNITED OPTICS CORPORATION, LEVENHUK
  • : 09.02.1970 .., : , 19
  • : 27.2 .., .: 80295571363, : www.ok.ru+ , id : 73468095,
  • : 01.01.1933 .., : ., -
  • : : www.ok.ru+ , id : 3218874,
  • - : 14.6.1928 .., : www.vk.com/id220506808.
  • : , .13 . : : , : 26.10.1998, : 2, :
  • : 25.09.1993 .., : .,..
  • ( .): 30.06.1954 .., : .
  • : 09.03.1984 .., : , ., . , 120
  • : : , : , : , .: , : , : www.ok.ru+ , : , : , id : 73182877, : ,
  • Glaser Alex: : www.vk.com/id221162300.
  • : 23.1.1962 .., : www.vk.com/id220820537.
  • Hmm.. Ololo?: 21.4 .., : www.ok.ru+Hmm.. Ololo?, id : 73323709,
  • HUAI'AN City Construction ( Group ) Company Huaiyin Branch: : LU,CHANGSONG, : construction installation engineering , decoration engineering ., : , 223002, Jiangsu, Huaiyin, No. 32, XINMIN DONG Road, .: (517) 3953095.
  • : 04.02.1971 .., : , .
  • Բ: : 1026011270, 03.02.1928 .., Ͳ - .., : , Ͳ
  • : : www.ok.ru+ , id : 73628228,
  • Kuz : : www.ok.ru+Kuz , id : 73527492,
  • : 27.11.1987 .., : ., -
  • : 10.06.1943 .., : 21043, 26602, , 1996 .., : 210430V0569206, 0569206, 4438714, .: 35182, : , , , 79.
  • : .: 8 9059109470, : . . 14
  • : 10.12.1957 .., : , . .5 .4
  • : - .., : , , , Death Race, , , , , Zombiland, : www.ok.ru+ , : , H , , Russia, , : Korn, Nirvana, Metalica, ACDC, Iron Maiden, KISS, Guns N Roses, Bon Jovi, Jimi Hendrix, Judas Priest, Twisted Sister, Manowar, Deth, Motorhead, Megadeth, Deathklock, id : 73758600,
  • : 8.9 .., - .., : www.vk.com/id220902182.
  • : 15.3 .., : www.ok.ru+ , id : 73276524, : ask.fm/SofyaOleksandrovna.
  • : 30.01.1979 .., : 650033, . , ., . 3
  • : : www.vk.com/id220941649.
  • : : www.vk.com/id219974721.
  • : 02.01.1936 .., : ., .113
  • : 1960 .., : . , , , 12.
  • : : www.ok.ru+ , id : 3174283,
  • : 10.6.1995 .., : www.ok.ru+ , id : 73834103,
  • : 20.10.1979 .., : .
  • Asgdf Sdfsdf: : www.ok.ru+Asgdf Sdfsdf, id : 73168325,
  • : . - .., : www.vk.com/id146550092.
  • , -, . 25474: - , , : ., . , , , 4, : (34368) 3-80-70 spa-prestige@mail.ru www.spa-prestige.ru
  • 27: : www.ok.ru+ 27, id : 73186703,
  • : 25.2.1975 .., .: 89042310224, : www.vk.com/id146842838.
  • : 1.4.1945 .., : www.ok.ru+ , id : 27770307, : www.koni.ru.
  • : : www.vk.com/id146885174.
  • : : www.vk.com/id146676333.
  • : 18.11.1973 .., : , . . 9/10, .: (495) 9307620
  • : 10.8 .., - .., .: SLMSUNG, : www.vk.com/id220131398.
  • : : , ., 8, .: (8) 9108189790.
  • : 28.09.1988 .., : ., . -, 111 .
  • : 16.01.1972 .., : , . .22 .2
  • Dlkdsq: : max_xv750@mail.ru
  • : 01.02.94 .., : , , .40 , 43
  • : 04.04.1966 .., : ., . , : 21074, 75147, 2002 .., : XTA21074021659655, 2106 6978462.
  • : .: 8 (921) 9973903, 5545334, 5545334, : , , . 14 --
  • : : www.vk.com/id220323861.
  • : .: 8 9084466499, : , , , 6
  • : 22.12.1986 .., : www.ok.ru+ , id : 3295172,
  • Joy Tilda: : www.vk.com/id220007233.
  • : 05.08.1998 .., . , . .53
  • : : www.ok.ru+ , id : 27981629,
  • : : EMO, : , : www.ok.ru+ , : , id : 73265745, : , , , ....,
  • : 29.10 .., .: 89509162038, : www.vk.com/id220451573.
  • Ҫ ò: : 3437201658, 08.02.1994 .., - .., : ,
  • : , . . 11, . (495) 3497920.
  • в : : 2906121570, 26.07.1979 .., - .., : ,
  • : : www.vk.com/id221123581.
  • : 7.1 .., .: 380672783653, : www.vk.com/id220697322.
  • : 16.12 .., : www.vk.com/id220249254.
  • : : www.vk.com/id220228322.
  • : 17.06.1948 .., : , . .57 .2
  • : 27.05.1937 .., : , ., 48
  • Petrova Lina: : www.vk.com/id220065405.
  • : .: 8 9038831597, :
  • : : www.vk.com/id220526554.
  • : .: 8 (4872) 346953, : , , , 14
  • : : www.vk.com/id220342603.
  • : ., .: 8 (3452) 677697.
  • : .: 380937348920, : www.vk.com/id220644054.
  • : 05.08.1927 .., , . . 8, . (495) 1773886.
  • : 27121976 .., - .., : - ..
  • : 05.05.1958 .., . - ..
  • : 13.05.2007 .., : , - , , 22
  • : : www.vk.com/id220714308.
  • : 22.02.1968 .. : . :
  • : 26.9 .., : _) ), - .., : )))), .: 1111111, : ), , )(((, : www.ok.ru+ , : , , , , , )))))))))))))))))))))))))))))), : , , _), id : 73412857, : , , , : www.nety.ua.
  • -: 12.11.1968 .., . - ..
  • : 27.01.55 .., : , , . , ., 16. : " ",
  • UNIVERSIDAD DE LA HABANA: .: 8783981, : , M # 255 VEDADO
  • () : - .., : www.ok.ru+ () , id : 73728966,
  • : 15.09.1975 .., , . . 4, . (495) 2590786.
  • : - "" (). : , , 13/12. : 32-61-30, 32-61-30. : 550000 .
  • : 06.08.1939 .., : , , , , 1
  • Sabirov Frenk: : www.vk.com/id146809412.
  • : 14.03.1929 .., : , , , ., ., 1
  • : 1924 .., : ., , , , 15
  • : 29.5.1996 .., : www.vk.com/id220072197.
  • : : www.vk.com/id220828128.
  • : 26.05.1957 .., : 443000, , ., : 21093, , , 88263, 2109301954995, 1954995, 1977448, 1996 ..
  • : 25.05.1949 .., , . . 13 . 8, . (495) 2780238.
  • : : www.ok.ru+ , id : 3126310,
  • *** : : www.ok.ru+*** , id : 73400818,
  • : .: 8 9092765196, : . - 38
  • : .: 9095608157, : . . 44 .19; : . . 44
  • : 4.5.1975 .., -3 - .., : , : www.ok.ru+ , : -, ., id : 73400367,
  • : 15.09.1962 .., : , , .( -).
  • : 6.12.1991 .., : NHL, NBA, , - .., .: 9056304999, : , Supernatural, , , , , : www.ok.ru+ , : Pendulum, Kaskade, deadmau5, Camo &, Krooked, Spor, Noisia, Sub Focus, Armin van Buuren, Tiesto, Receptor, Black Sun Empire, The Qemists, Netsky, Datsik, Excision, Mt Eden, Flux Pavillion, Skrillex, id : 27776825, : dubstep, drum and bass,
  • ..: , . . 30 . 2 ,
  • : : www.ok.ru+ , id : 73231212,
  • : : www.ok.ru+ , id : 73670022,
  • : 28.05.1967 .., : 21093, 94702, , 21083, 1997 .., : 210930W2239859, 2239859, 2290251, : , , , 40.
  • : 600205 .., - .., : ., , , . 21, : 2104, 21043, 45135, 1996 ..
  • : - " "". : , 3/. : 25-77-82, 25-77-82. : 1000000 .
  • Sahin Mahmut-Erdener: 26.8.1990 .., : www.vk.com/id220658295.
  • : 09.10.1966 .., : , , , 47.
  • : : www.ok.ru+ , id : 73087576,
  • : 26.02.1936 .., : ., , , .18
  • : 03.05.1967 .., : ., , . , . , .10
  • Bonnett Jonathan: 30.12.1981 .., : www.vk.com/id221207490.
  • , , : , 4843, 1990 ..
  • : : www.ok.ru+ , id : 73181776,
  • : 06.06.1972 .., : ., . - . - 26, .: 8 (812) 5941921, : 405, 939478, 1987 .., : VF315BB2208024861, B2A 008330.
  • : 16.01.2003 .., : , .83
  • : 9.10 .., : Sonik, : www.ok.ru+ , id : 3098010,
  • : 21.8.1986 .., - .., : www.ok.ru+ , id : 3075082,
  • : .: 89050653025 (), : . . 26
  • 06.08.1974 ..: : ., . . .44
  • : 21.10.1981 .., : , , , 99/3. : " "
  • : 28.11.1990 .., - .., : www.ok.ru+ , id : 73769857,
  • : 15.2.1982 .., : www.ok.ru+ , id : 3163734,
  • : 23.02.1990 .., : , .
  • : : www.ok.ru+ , id : 27793306,
  • : 24.01.1960 .., : , .
  • : : www.vk.com/id220729655.
  • : 4.5 .., . - .., : www.vk.com/id220955633.
  • Gfwrgfuygruygwfyufwgfw Iuwdiudhwiuwdhiuwhwidu: : www.ok.ru+Gfwrgfuygruygwfyufwgfw Iuwdiudhwiuwdhiuwhwidu, id : 73366034,
  • : : www.ok.ru+ , id : 73202957,
  • : : www.vk.com/id146572325.
  • : 19.09.1955 .., : ., , . , 2 , .18
  • : 16.07.2001 .., : , , , 26
  • : 14.05.1973 .., , . . 41, . (495) 4173018.
  • : : www.ok.ru+ , id : 73193379,
  • B.s Oryngul: : www.ok.ru+B.s Oryngul, id : 73660982,
  • : 08.11.1947 .., : -, : , .
  • : : www.vk.com/id220609319.
  • : 18.03.1972 .., : , ., 28. : "" , : , 7, .: 412100
  • : : www.ok.ru+ , id : 27958152,
  • : 27.3 .., : www.ok.ru+ , id : 73713121,
  • : 09.11.1958 .., :
  • : : www.vk.com/id221113816.
  • : 10.07.1926 .., , . . 9, . (495) 2157664.
  • : - "". : , 1. : 72-15-75 44-59-74, 72-15-75 44-59-74. : 1000000 .
  • : 17.11.1945 .., :
  • : 10.5.1990 .., : www.vk.com/id220542560.
  • : 10.11 .., : www.ok.ru+ , id : 3286903,
  • 9601027248 PRE_PAY: . .: 8 9601027248,
  • TAICANG City Cement in bulk Office: : XING,GAOQIAN, : organize put in practice , inspection intendance , plan as a whole wield all city development cement in bulk fund , plait plan, : , 215400, Jiangsu, Suzhou, No. 16, TAIPING NAN Road, CHENGXIANG Town, .: (520) 3531219.
  • : .: 89601238340 (), : ., . , . , .110
  • : : www.ok.ru+ , id : 73212377,
  • : : , - .27 .1
  • : 26.6.1984 .., : www.ok.ru+ , id : 3197719, : http://dnevnik.cc/id3197719.
  • : 01.06.1952 .., : , -, , 6 : . .. .
  • : NISSAN SERENA, (), , , , 259488, 1993 .., : , :
  • : 31.05.1981 .., : HYUNDAI ACCENT, -, 894152, X7MCF41BP6M074909, 2006 .., : , 52
  • : : ., . -, 14
  • : : www.vk.com/id146545679.
  • : 09.06.1937 .., : . -, -, ., 15, .: (812) 5877602.
  • : 16.01.1986 .., : - , ., ., 14
  • Dsadasdada Sadasdas: : www.ok.ru+Dsadasdada Sadasdas, id : 73610657,
  • : 12.10.1970 .., : 2140, 11002, , 1986 .., : 579330, 1968843, 0014632, : , , , 22.
  • : : www.ok.ru+ , id : 73714294,
  • : 13.3.1988 .., - .., : www.vk.com/id220187074.
  • : : www.vk.com/id220973742.
  • : : www.vk.com/id220749755.
  • : 11.11.1977 .., : , . .24/35
  • : 17.11 .., - .., .: +3752*6*2*55*, : www.vk.com/id220910353.
  • : 25101988 .., - .., : - . . .18
  • : 01.01.1930 .., : , .916
  • : 880228 .., - .., : ., , , . 32, : , 7.107, 082035, 1993 ..
  • : : www.ok.ru+ , id : 3198846,
  • "" - "": , : 834900 ., ./: 555-08-24, : - , : 7801104117, : 48923837, : , , , : 199053, 000000.
  • Rushman Rushman: : 5, : www.ok.ru+Rushman Rushman, id : 73284821,
  • : 02.06.1973 .., : ., . -, 22
  • Alex Alex: : www.vk.com/id220439739.
  • "-" ( "-"): .: 03.08.2009 ., : 6027097030, : 1066027044104, : 602701001, : 58401000000, : .2 .21.1 08.08.2001 129-, : , , -, 50.
  • : 01.01.1946 .., : , .
  • : 22.12.1981 .., - .., : www.ok.ru+ , id : 73499042,
  • : .: 8 (921) 6481469, 2748557
  • : : , , 20.08.1951 .. . 2
  • : 21.11.2000 .., : www.ok.ru+ , id : 73371968,
  • : 03.09.1977 .., : (), . , 16
  • : . - .., : www.ok.ru+ , id : 73284541,
  • : 16.7.1995 .., .: HTC ONE))), : www.vk.com/id220761262.
  • : : www.ok.ru+ , id : 3100980,
  • : : ., .- . - 13, : 412, 4000, 1975 .., : 0907854.
  • : : www.vk.com/id220261182.
  • Nozeman J G M: .: 715661473, : , , 2313XR, Leiden, Staalwijkstraat, 26.
  • : 13.11.1954 .., : " 141", : ., .30
  • : 3.2 .., : , : , - .., : , : , : www.ok.ru+ , : , : , id : 73327648, : ,
  • : - .., : www.vk.com/id146679306.
  • : 17.12.1996 .., : www.vk.com/id220182691.
  • : 12.6 .., : www.vk.com/id221091142.
  • : 01.01.1958 .., : ., , , 70.
  • ? ?: : www.vk.com/id220417769.
  • : 15.10.1976 .., - .., .: , : www.vk.com/id220903844.
  • : : www.vk.com/id220154049.
  • : : , .: 6525831.
  • : 6.5.1994 .., : www.vk.com/id220566884.
  • ³: 25.6.1994 .., : , !, - .., .: 8098*****60, : vi.chaus, : www.ok.ru+ ³, id : 73114417,
  • : : www.vk.com/id220927230.
  • ZHANGJIAGANG City CHANGHONG Service station: : WANG,YUMING, : diesel , petrol retail, : , 215625, Jiangsu, Suzhou, JINFENG Town, .: (520) 8550807.
  • 9610201576 PRE_PAY: . .: 8 9610201576,
  • : : www.ok.ru+ , id : 73851357,
  • : 28.05.1933 .., H . H H - .., : (.: 05.06.2003 "H" H . H) 9/95, .
  • : : www.vk.com/id146555677.
  • Gazezov Anuar: 28.1 .., : www.vk.com/id220696109.
  • : ..: 8 9172431138, : , . , . . , . ,
  • : 08.02.1998 .., : , , , 1. : ,
  • Zhailauov Nurlybek: 10.12.1990 .., - .., : www.vk.com/id220744155.
  • : : , . . 183/36, . (495) 3761684.
  • : 8.1.1991 .., - .., .: 06850*****, : marichka.olyshansyka, : www.vk.com/id146897581.
  • : : 1067746321180, "" 0 1067746321180
  • : 04.10.1982 .., : , . .1
  • - : : www.vk.com/id146537648.
  • : 03.10.1971 .., : , . --, ., 57. : 132 , : , , 37, : , .: 220817.
  • : 10.04.1948 .., . - ..
  • Encheva Steliana-Encheva: 12.1.1999 .., ??cosia - .., : www.vk.com/id220912848.
  • ò : : 2818621916, 03.03.1977 .., Ʋ - .., : ,
  • Vorona Polinka: 11.6 .., : www.ok.ru+Vorona Polinka, id : 3243632,
  • : : 1516215573, 06.07.1941 .., - .., : , ͪ
  • : ²²Ͳ "- Բ "" ( ""), : , 1133 ȯ, . в, .36, .2, .: , 1133 .ȯ, -, . в, .36, .2, .: ̲Ͳֲ ̲ Ȫ, 25322, 07.04.2003 ., : 1) 2327612318, ̲Ҳ Ͳ в , . 2274381 2) 2333502570, ò ² , . 2954114 3) 2449111033, ˲ ò , . 2581580, : : 21150 ' : 01.11.0 i , ..: 2959114 ..: 2959114.
  • : 23.05.1944 .., . , . .7 .2
  • : 1.7.1989 .., : Dok^+, - .., : www.vk.com/id146484459.
  • J. Karolina: : www.vk.com/id146844353.
  • : : www.vk.com/id220108699.
  • : 5.11.1975 .., : www.vk.com/id220109123.
  • Chevelier Alexandre: : www.vk.com/id220158409.
  • : - .., : www.ok.ru+ , id : 73441821,
  • Vika Shachanyn: : catss_98@mail.ru
  • : 12.05.53 .., : , , ., 70. : , 454048, ., 24
  • : , - .., : www.ok.ru+ , id : 73717325,
  • : 22.5 .., : d[ SAINT | ]d, : www.ok.ru+ , : saint_src, id : 3178920, : http://www.s-recordz.com/.
  • Suleymanov Suleyman: : www.vk.com/id220906581.
  • : 11.05.1966 .., : , .
  • ˲: : 3232611658, 03.07.1988 .., - .., : ,
  • : SUBARU IMPREZA, , , , , 252627, 1996 .., : , :
  • : 24.05.1972 .., : . . , , 103. : "", : , 680000 . . 56 ( 43), : , .: 22-23-69.
  • : 4.12.1986 .., : www.ok.ru+ , id : 3218737,
  • : 06.12.1955 .., : , 25
  • : 08.10.1938 .., : , , ., 29, : 24-10, 839177, 1988 ..
  • : 22.9.1999 .., - .., : www.vk.com/id220100494.
  • : 15.08.1948 ..
  • Villamarin Alejandro: : www.vk.com/id220019703.
  • : 26.03.1957 .., : 654055, , -, , ., . 1
  • : 1936 .., : ., , , , 18
  • : 27.3.1920 .., : www.vk.com/id146720545.
  • : 1938 .., : , , .
  • I I I: .: 80656372470, 80656372134, +380667191493, : , I , -, . , . , . 5
  • "" 5024018101 1025002877844: ./: 5643193, 0, : 143401, , , , , 7
  • : 20.05.1960 .., : , - , , 3.
  • : : www.vk.com/id146538302.
  • : 15.03.1946 .., : , . . 11, .: (495) 2467031
  • Kooij-Nijs M J: .: 365499736, : , , 1338JG, Almere, Wisentstraat, 13.
  • : 20.11.1938 .., - - ..
  • SUZHOU City CANGLANG District FUXING Boiler auxiliary machine equipment Service: : LI,CHANGJIN, : boiler auxiliary machine equipment repair , , electric welding , pipe installation, : , 215007, Jiangsu, Suzhou, No. 206, PANMEN Road, .: (512) 8219923.
  • : 4.2 .., : www.ok.ru+ , id : 27824111,
  • : 23.12.1960 .., : , , , 24
  • : - .., : www.vk.com/id220830577.
  • 09.08.2005 ..: : ., . .123
  • : .: 8 9601339471, : 000000, . , . , .85
  • : 29.11.1960 .., : . 474.
  • : 12.9 .., : www.ok.ru+ , id : 3173441,
  • ..... {{{vadim}}}: : www.ok.ru+..... {{{vadim}}}, id : 73250854,
  • Fighter Baloon: : www.ok.ru+Fighter Baloon, id : 27870394,
  • : 22.09.1918 .., : , 12
  • : 07.06.1982 .., : / . -
  • : : www.vk.com/id220702183.
  • : TOYOTA CROWN, (), , , , 257548, 1997 .., : , :
  • : 02/24/78 .., : ., . , , 22
  • : - .., : www.ok.ru+ , id : 73407326,
  • : 02.12.1988 .., : , , , 5
  • : 5.8.1991 .., : www.vk.com/id220434124.
  • SIHONG County DAZHONG Automobile Service Center: : XU,NAIYING, : service : automobile ., : , 223900, Jiangsu, Suqian, SHANHE Road, .: (527) 6223022.
  • Sadaqq Adadqq: : www.ok.ru+Sadaqq Adadqq, id : 73334780,
  • : 06.08.1981 .., : 21103, -, 58552, XTA21103040693010, 2004 .., : , 7
  • : 26.02.1981 .., : / .
  • : 01.02.1966 .., , . . 57 . 2, . (495) 4784511.
  • : 20.01.1962 .., : 21061, 50102, , 2103, 1991 .., : XTA210610M2647249, 2647249, 1852588, : , , , 48.
  • : 15.11.1956 .., : 443011, , , , 220 31, : 21122, , -, 41463 *, 21122030122287, 0122287, 0739262, 2003 ..
  • : 13.05.1975 .. : . :
  • : 21.3 .., : , !!!!! - .., : www.ok.ru+ , id : 73140514,
  • : .: +7 (499) 968-56-99, +7 (495) 221-72-26, : ., ., . , 14, 4lapy.ru, : , , , , , , ,
  • ..: : ., , , 31, .: 8 (8184) 557141.
  • : : . ., : , - .., : ., : , : www.ok.ru+ , : ---, : 30 sek To Mars, id : 73466437, : , : ----.
  • : 15.11.1938 .., : ., . -, 60
  • Sad Sad: : www.ok.ru+Sad Sad, id : 73519178,
  • : : , : , : , .: NoKiA, : , : www.ok.ru+ , : Comedy Club, : , id : 73117715, : )), : http://vkontakte.ru/id73117715.
  • : : www.ok.ru+ , id : 73362982,
  • : .: 89857832754 - , . SDHC 16Gb , Class10 , , , Full HD . ( , Transcend sdhc16Gb Class10 TS16gsdhc, , : , : 495 .), : , .
  • Mkvdari Mkvdari: : www.ok.ru+Mkvdari Mkvdari, id : 73073401,
  • Casablancas Alan: 30.7.1993 .., Mexicano - .., : www.vk.com/id220580028.
  • : 06.01.1926 .., : , . . 11, .: (495) 3976119
  • : 18.10.2004 .., : , .62 .2
  • : : , 1
  • : 29.03.1976 .., : . -, -, ., 30, .: (812) 2605665.
  • : 01.01.1935 .., , . . 8, . (495) 1739030.
  • : 30.07.1958 .., , . 94 . 2, . (495) 3921444.
  • : 18.01.1971 .., : , . .51 .3
  • : 8.5.1996 .., : www.vk.com/id221077501.
  • : - .., .: 89515836787, : www.ok.ru+ , id : 73730154,
  • : : www.vk.com/id220989427.
  • : 19.7 .., - .., .: 380965381220, : www.vk.com/id221112429.
  • : 14.02.1946 .., : , . . 53 . 3, .: (495) 4553648
  • : 13.5 .., - .., : www.vk.com/id221012146.
  • : : www.vk.com/id220847173.
  • : 1.9.1992 .., : ____________MogggooooooM88888, ________MMMMMoooooooooooM8888888, ________M6ooooMMMmoooooooM888888888, _____Mmooo8oooooooooooooM88888888888, ____MmmmooooooooooooooM88888888888888, ___Moooooooooo8888888M8888888888888888, __Mooooooooooooo88888M88888888888888888, ___MmooooooooooooooommM88888888888888888, _______M88ooooo888mooMM88888888888888888, ________M88888888oommooM88888888888888888, _________M888888ooooMM8888888888888888888, _________MooooooooooM888888888888888888888, ______888MoooooooooM8888888888888888888888, ___888888MooooooooM88888888888888888888888, __88888888MoooooooM8888888888mmmm888888888, _888888888Mo8oooooM8888888MooooooooM888888, 8888888888Moo8oooM8888MM8ooooooooooooM88888, 8888888888Mooo88ooooM888MoooooooooooooM8888, _M8o8888ooo8oo88ooo0ooMMoo888oooooooooooM88, Mooo88888ooo8o88o8oooooooooo8888oooooooooM8, Moo8888o8ooooo8ooooooooooooooo8888ooooooooM8, Mooo88oooooooooooooooooooooooo888888oooooooM8, Mooooooooooooooooooooooooooooo88888888ooooooM8, _MooMooooooooooooooooooooooooooM888ooo88oooooM, __Mmoooooooooooooooooooooooooo888Moooo8oooooooM, ___Moooooooooo8oooooooooooooo8888MMooooooooooooM, ____Moooooooo88ooooooooooooo88888MMM8oooooooooooM, ____Moooooooo88oooooooooooooo88888MMMMoooooooooooM, ____Moooooooo88Moooooooooooooooo88888MMMMoooooooooM, ___Mooooooooo88Moooooooooooooooo8MooooMMMMoooooooooM, __Mooooooooo8MMooooooooooooooo88MoooooMMMMooooooooooM, _Mooooooooo88MMoom888mooooooo88MooooooMM_MMoooooooooo, _M8moooooo888MMoom@@8moooo8888M8oooooooMM__MMooooooo, M@88moooo888MooMom8@8mooo8888MooooooooMM___Mmoooooo0, _*M8mooo8888MooooMm8mooo888M888ooooooooMM___Moooooo00, ____MMMMMM8888oooooMMmmmmM88888oooooooMM_Moooooooo0, __________M88Moooooo8888888888oooooooooooMMoooooooooo, __________M88Mooooo8o888888888ooooooooooooMoooooooo88, ___________M88Mooooo8ooo888888oooooooooooMooooooo8888, ____________M888Mooo888ooooo888ooooooooooMoooooo8888M, ____________M88888Moo888oooooo8888ooooooMooooooo888M8, _____________M888888Mo8888oooooo8888oooMooooooo888M88, ______________M8888888Mo8888ooooooooooMoooooooo88M888, ________________M888888M88888oooooooooMoooooooo8M8888, _________________M8oo888M888888ooooooMoooooooo8M88888, __________________M8ooooMM88888888ooMooooooooM8888ooo, ___________________MooooM_M88888888MooooooooM888ooooo, ____________________MooooM_M888888Mooooooo8M88**ooooo, _____________________MooooM_mmmmmmMoooooo8Mmooooooooo, ______________________MoooQooommmmMoooMMooooooooooooo, _____________________MM88ooo8ooooMMMooooooooooooooooo, __________________mM8888M88o88mMmoooooooooooooooooooo, ____________mMMMoooooooooM888Mmoooooooooooooooooooooo, _______MMMMoooooooooooooooMMooooooooooooooooooooooooo, ___MMMoooooooooooooooooMMoooooooooooooooooooooooooooo, MMMooooooooooooooooooMMooooooooooooooooooooooooooooo8, oooooooooooooooooooMMooooooooooooooooooooooooooooo888, oooooooooooooooooMMooooooooooooooooooooooooooo8888888, oooooooooooooooMMoooooooooooooooooooooooooo8888888888, oooooooooooooMooooooooooooooooooooooooooo88888888888M, ooooooooooooMooooooooooooooooooooooooo8888888888M____, oooooooo88Mooooooooooooooooooooooo88888888888M_______, oo8888888Mooooooooooooooooooooo888888MMMMMMMMMMMM888, 8888MMMMMooooooooooooooooooooo8888M888888888888888888, 8MMM888Moooooooooooooooooooo88M8ooooooooooo8888888888, 88oooooMoooooooooooooooooooMMoooooo888888888888888888, 8888888M8888oooooo88ooooooMoo888888888888888888888MM, MMMMMMMM888888ooo88888oo8Mo888888888888888888MM, __________M8888888888888Mo888888888888MMM, ____________M88888888888MMMMMMM, _______________MMMMM, - .., : ____________MogggooooooM88888, ________MMMMMoooooooooooM8888888, ________M6ooooMMMmoooooooM888888888, _____Mmooo8oooooooooooooM88888888888, ____MmmmooooooooooooooM88888888888888, ___Moooooooooo8888888M8888888888888888, __Mooooooooooooo88888M88888888888888888, ___MmooooooooooooooommM88888888888888888, _______M88ooooo888mooMM88888888888888888, ________M88888888oommooM88888888888888888, _________M888888ooooMM8888888888888888888, _________MooooooooooM888888888888888888888, ______888MoooooooooM8888888888888888888888, ___888888MooooooooM88888888888888888888888, __88888888MoooooooM8888888888mmmm888888888, _888888888Mo8oooooM8888888MooooooooM888888, 8888888888Moo8oooM8888MM8ooooooooooooM88888, 8888888888Mooo88ooooM888MoooooooooooooM8888, _M8o8888ooo8oo88ooo0ooMMoo888oooooooooooM88, Mooo88888ooo8o88o8oooooooooo8888oooooooooM8, Moo8888o8ooooo8ooooooooooooooo8888ooooooooM8, Mooo88oooooooooooooooooooooooo888888oooooooM8, Mooooooooooooooooooooooooooooo88888888ooooooM8, _MooMooooooooooooooooooooooooooM888ooo88oooooM, __Mmoooooooooooooooooooooooooo888Moooo8oooooooM, ___Moooooooooo8oooooooooooooo8888MMooooooooooooM, ____Moooooooo88ooooooooooooo88888MMM8oooooooooooM, ____Moooooooo88oooooooooooooo88888MMMMoooooooooooM, ____Moooooooo88Moooooooooooooooo88888MMMMoooooooooM, ___Mooooooooo88Moooooooooooooooo8MooooMMMMoooooooooM, __Mooooooooo8MMooooooooooooooo88MoooooMMMMooooooooooM, _Mooooooooo88MMoom888mooooooo88MooooooMM_MMoooooooooo, _M8moooooo888MMoom@@8moooo8888M8oooooooMM__MMooooooo, M@88moooo888MooMom8@8mooo8888MooooooooMM___Mmoooooo0, _*M8mooo8888MooooMm8mooo888M888ooooooooMM___Moooooo00, ____MMMMMM8888oooooMMmmmmM88888oooooooMM_Moooooooo0, __________M88Moooooo8888888888oooooooooooMMoooooooooo, __________M88Mooooo8o888888888ooooooooooooMoooooooo88, ___________M88Mooooo8ooo888888oooooooooooMooooooo8888, ____________M888Mooo888ooooo888ooooooooooMoooooo8888M, ____________M88888Moo888oooooo8888ooooooMooooooo888M8, _____________M888888Mo8888oooooo8888oooMooooooo888M88, ______________M8888888Mo8888ooooooooooMoooooooo88M888, ________________M888888M88888oooooooooMoooooooo8M8888, _________________M8oo888M888888ooooooMoooooooo8M88888, __________________M8ooooMM88888888ooMooooooooM8888ooo, ___________________MooooM_M88888888MooooooooM888ooooo, ____________________MooooM_M888888Mooooooo8M88**ooooo, _____________________MooooM_mmmmmmMoooooo8Mmooooooooo, ______________________MoooQooommmmMoooMMooooooooooooo, _____________________MM88ooo8ooooMMMooooooooooooooooo, __________________mM8888M88o88mMmoooooooooooooooooooo, ____________mMMMoooooooooM888Mmoooooooooooooooooooooo, _______MMMMoooooooooooooooMMooooooooooooooooooooooooo, ___MMMoooooooooooooooooMMoooooooooooooooooooooooooooo, MMMooooooooooooooooooMMooooooooooooooooooooooooooooo8, oooooooooooooooooooMMooooooooooooooooooooooooooooo888, oooooooooooooooooMMooooooooooooooooooooooooooo8888888, oooooooooooooooMMoooooooooooooooooooooooooo8888888888, oooooooooooooMooooooooooooooooooooooooooo88888888888M, ooooooooooooMooooooooooooooooooooooooo8888888888M____, oooooooo88Mooooooooooooooooooooooo88888888888M_______, oo8888888Mooooooooooooooooooooo888888MMMMMMMMMMMM888, 8888MMMMMooooooooooooooooooooo8888M888888888888888888, 8MMM888Moooooooooooooooooooo88M8ooooooooooo8888888888, 88oooooMoooooooooooooooooooMMoooooo888888888888888888, 8888888M8888oooooo88ooooooMoo888888888888888888888MM, MMMMMMMM888888ooo88888oo8Mo888888888888888888MM, __________M8888888888888Mo888888888888MMM, ____________M88888888888MMMMMMM, _______________MMMMM, .: 9379992, : www.ok.ru+ , : , : AMATORY , id : 73578411, : PARTY, : ..
  • : : www.vk.com/id220449341.
  • : 15.05.1967 .., : 21053, 11602, , 1993 .., : 2105301433441, 1433441, 3109588, : , .
  • 070: : , 2.
  • : : , : , - - .., : , .: 8931, : , : www.ok.ru+ , : , : , id : 73705283, : , : .
  • Forse Berni: : www.vk.com/id220983155.
  • : 15.9.1979 .., : www.ok.ru+ , id : 27909995,
  • : 02.11.1928 .., : , . .5 .2
  • Grinenko Karina: : www.vk.com/id146835538.
  • : 16.09.1987 .., : / .
  • Dallas Las: : www.vk.com/id219984785.
  • : : www.vk.com/id220972690.
  • WUXIAN City DONGSHAN XINJIAN Feathers & downs garment Factory: : WU,TONGZHEN, : , 215107, Jiangsu, Suzhou, XINJIAN Village, DONGSHAN Town.
  • : 15.01.1930 .., :
  • : : www.ok.ru+ , id : 73226925,
  • : 15.11.1953 .., : ., , . , , .15
  • : 20.09.1928 .., : . 15.
  • : .: 80552235794, +380504478937, : , 73000, , ., . , .6
  • : : www.vk.com/id220125445.
  • : 26.05.1930 .., : ,
  • : 1941 .., : , , , ., ., 24
  • Zv Vlad: : www.ok.ru+Zv Vlad, id : 73134957,
  • : : www.vk.com/id146534738.
  • : .: 89144869942 (), : . (.), , , ,
  • : 01.01.1900 .., : , - 5940200000, ., 62, : , 3, 1455, 1981 .., : 0, 3154.
  • ( .): 05.07.1930 .., -,. - .., : ., , : -, . H.,.150,
  • : 15.10.1955 .., : , - , , 19.
  • ..: , . . 3 . 2 ,
  • : 08.04.1926 .., . , ., 2
  • : 07.09.1948 .., : , . 55,
  • : 13.09.1917 .., , . . 12, . (495) 2787763.
  • : 01.01.1961 .., : , 19234013 .. , , : 18.07.1997
  • : 05.02.1964 .., : , . .12 .1
  • : 5.8.1998 .., : ayqulkaa, : www.vk.com/id220322598.
  • : 18.09.1966 .., : - , ., ., 43
  • Hshsh Dshhg: .: sdhshs, : www.ok.ru+Hshsh Dshhg, id : 73132945, : shsh.
  • : 01.01.1958 .., : . . . 48
  • : : www.vk.com/id220665126.
  • : : , : www.ok.ru+ , id : 73632974,
  • : 07.11.69 .., : , , . , ., 24. : ..." .. "", 455000, . , 99
  • : : 3055822319, 31.08.1983 .., - .., : ,
  • : 26.11.1954 .., - .., : www.vk.com/id220186527.
  • : ..: 8 9172612134, : , . , 75, . , . ,
  • . . 0111837: . .: 8 9017111837, :
  • Ҹ: - .., .: 89161910291, : www.ok.ru+ Ҹ, id : 73496286,
  • : 11.12.2000 .., - .., .: , : , : www.vk.com/id146834825.
  • : 12.4.1987 .., : www.vk.com/id220660569.
  • " " - " ": , : 0 ., ./: 254-92-03, 254-92-03, : - , : 7805112366, : 49000164, : , : 198216, 198216, 254-92-03.
  • Kogevnikov Stas: 16.12.1994 .., : http://vkontakte.ru/id77434724 , - .., .: , : www.ok.ru+Kogevnikov Stas, id : 73859693, : ///******///.
  • : thedecoratingcentre.com, 5147, Shops & other Retail Outlets, Decorators' Merchants, : , , 9-11 Ainsty Road, Wetherby, West Yorkshire, Yorkshire & The Humber, LS22 7QN, LS22 7QN, Yorkshire & The Humber, West Yorkshire, Wetherby, .: 441937580980, www.thedecoratingcentre.com, : Mr T Shave (Director)
  • : 01.01.1900 .., : , - 5925050100, ., 41, : , 2715101, 2852, 1986 .., : 0204676.
  • : : www.vk.com/id220631471.
  • в в: : 3138712538, 07.12.1985 .., - .., : ,
  • : : , . . 19, . (495) 4505461.
  • : 01.05.1977 .., : , . .16 .2
  • : 27.4 .., : , , , , , , , , , , - , , . , . , , . , , . , . . , , , . , , , . - . , , : (mrSmail), : Lineage2---STALKER(1.2)-----DOTA---CS1.----BIONIK-------NFS------ 3 5------- The Witcher, - .., : (), .: Lg(kg195) , : (1-2), , , , (1-2), : www.ok.ru+ , : 11111111111111111111111111111111111111111111111111111, 000*111111111111111111111111111111111111111111111111111, 000011111111111111111111111111111111111111*1111111111**, 0000111111*1*116*111*1111111111111111168111111111111100, 00001111111*1118011111*1111111118111116811111*111111100, 0000*1111***1*180111118*1*1111118**11168111118111111100, 000011*1*81111*8611111811*111111681*11081111681*11111**, 00001111180111*880*11861111111111811*068*1118*111111111, *00*1111*686801___1688111*1111*11886____168881111111111, 00*11111118__________1811*11111181__________80111111111, 1111*1*10*_____________861111108_____________1811111111, 1111111**_______________16111*1_______________161111111, 11111118_________________81118_________________81111111, 111111**__________________61*1_____1____________6111111, 0111118__________88688____818___180*08*_________8811111, 0*1118*_________8111116____**__16*11*10*_________811111, 001118_________8*1088**81__8__*810888*18_________*11111, 001116_________6188888108__8__8*18888810__________*1111, 0*1110_________0188888**8__8__8**88888**__________*1111, *11116_________0188888108__8__8*18888810__________01111, 111118_________8*6888818*__8__1810888**8__________*1111, 1111181_________*11**10*__8880_16111*16__________611111, 1111108_________180**8*__8111180_86688__________*811111, 11111160*1_________1____81111118______________600*6*111, 11111000601_____________81111*_8_____________0*11110111, 11110110110____________181111116____________01116*11011, 111011*11*10___________08_11*118____________0111111*101, 1101011111101_________8*10111*888___________01111**1101, 11011*1*111*6______1881*1*11*161166_______680**86**1101, 11011111811*1*888880111111111811111*88888011*1180*11101, ***11*16111*111111111111111*111111111111111111881111**1, 11101111801*11111111111111*11*111111111111*16888_11**11, 1111111188801111111111111111*111111111111188888811**111, 111111*1888888*1111111111111111111111111888888801111111, 11111111*88886888*11*1111111111111111088888888811111111, 111111111888888888888011111111111*888888888888811111111, 111111*11688888888888108888888881__88888888868011111111, 111111111088868888886____1688*_____88888888868111111111, 11*111111188888888881_____888*_____88888888868111111111, 1*001111116888888888______886*_____8888888888**11111111, 10001111111888888868______8880_____8888888888110000*111, 1000111111108888888888888688886888888888888811000000*11, 1*0*111111*1*888888888888888888888868888888011000000011, 11*11111111*188888888888888688888888888688611*000000011, 111111111***1186888888888888888888868888861*1*000000011, 11111111000001188888*1111168111111*8886801*11*000000*11, 1111111*0000011188*111111111111111118881111111000000111, 111111100000011*1*8611111111111111188011111111*000*1111, 11111110000001*11111880111111*0088011111111111111111111, 111111100000011111111088888888886*11111111111*111111111, 111111100000*1111**111111111111111111111111111111111111, 11111110000*1111111*11111111111111*11111111*00111111111, 11111111***1111111111**11*1**11**111111111*00011111111111, 111111111111111111111111111111111111111111 ?-. .Comedi-clab.95, : ), id : 27991288, : ```88888888888888888888888888888888oo88888888888888888``` ``888888888888888888888888888888o``````o88888888888888o`` ``88888888888888888888888888888o````````o8888888888888o`` ``888888888888888888888888888888```````o88888888888888o`` ``8888888888888888888888888888888oo`ooooooo88888888888o`` ``88888888888888888888888oo```oo88888o```````888888888o`` ``8888888888888888888888o```````o888o`````````o8888888o`` ``88888888888888oo```o88````````o88o```````````o888888o`` ``88888888888oo````````oo```````88o`````````````o88888o`` ``88888888o`````````````o88ooo888o```````````````o8888o`` ``o888o``````````````````o888888``````o8o`````````o888o`` ``88o````````````````````````````````8888o`````````o88o`` ``88````````````o88888`````````````o888888`````````o88o`` ``88```````````o8888888ooo`ooooooo88888o```````````o88o`` ``88``````````````o88888888888888888o``````````````o88o`` ``88``````oo`````````8888888888888o```````o888`````o88o`` ``88`````o8888oo``````o88888888888o`````888888o````o88o`` ``88`````o8888888o`````o8888888888o````o888888o````o88o`` ``oo`````o88888888o`````o888888888o````o888888o`````ooo`` `````````8888888888o`````o88888888`````o8888888`````````` ``````oo8888888888888``````8888888`````o888888888o``````` ```o888888888888888888``````888888`````o8888888888888```` ``o88888888888888888888o````o88888o````o88888888888888o`` ``8888888888888888888888o``o8888888o``o888888888888888o`` ``oo8888888888888888888888888888888888888 )))))!!, : http://HtTp//\@.net .
  • : 05.09.1975 .., : ., . -, 4
  • "" - "": , .: 13.09.2002 ., : 840000 ., ./: 534-82-27, 534-82-27, : - , : 7804094315, : 50883755, : , : 195220, 195220, 534-82-27.
  • : 31.7 .., : *Princess*, : www.ok.ru+ , id : 3144052, : http://vkontakte.ru/id3144052.
  • : 28.1.2000 .., - - .., .: 0679902323, : lexa_mikityuk, : www.vk.com/id146479264.
  • в: : 3150216579, 01.04.1986 .., - .., : ,
  • : 01.01.1981 .., : ., . -, 4
  • : 02.01.1983 .. : . :
  • : 01.10.1978 .., : ., , , 121.
  • : : www.vk.com/id220980809.
  • : 4.9 .., : , - .., : , : , : Fransuza1, : www.ok.ru+ , : , : , id : 3282796, : - , , . ,
  • : : www.vk.com/id220927400.
  • : 18.04.1956 .., : , . . . 12, .: (495) 1522059
  • "" ( ""): .: 28.10.2004 ., : 5404116313, : 1045401519371, : 540401001, : , : 630136, , , , 11.
  • "": . .: 8 9059671205, : 654041 . . . 23
  • : .: 8 9242350733, : , ; , 4
  • : 01.01.1900 .., : , - 5940100000, ., 93, : , 21013, 4038, 1980 .., : 3576445, 3525129.
  • : : www.vk.com/id220719437.
  • : : www.ok.ru+ , id : 73792803,
  • : : www.ok.ru+ , id : 73512542,
  • Bolgan4ik_88: : www.ok.ru+ Bolgan4ik_88, id : 73324401,
  • : 27.3.1984 .., : www.ok.ru+ , id : 73369872,
  • : 26.05.1992 .., : , .
  • : 09.11.1949 .., : , , -.
  • : : 3046026915, 25.05.1983 .., - .., : ,
  • : 18.8.1977 .., .: 09681930..., : www.vk.com/id220334764.
  • : .: 8 9241003936, : , ; , 37
  • : 19.03.1992 .., : , , . .11 .1
  • : : www.vk.com/id146746413.
  • : 15.12.1976 .., : , . .58 .3
  • в: : 1330126451, 01.06.1936 .., - .., : ,
  • Tunc Mehmet: : www.vk.com/id220550783.
  • : : www.ok.ru+ , id : 73137925,
  • : .: 8 (3822) 362150, : , . , ., 130
  • : : , : , : , .: 84935724255, : , : www.ok.ru+ , : , : , id : 73630327, : ,
  • : 06.01.1965 .., : , . .40 .
  • : : , ., : , , - .., : . , : , , , , : www.ok.ru+ , : , id : 73804461, : , , , ,
  • Triboulat Yohan: : www.vk.com/id220793689.
  • : 27.07.1944 .., : , . .16
  • : : , - .., : , : , , , : www.ok.ru+ , : , : , id : 73572679,
  • : 13.11.1936 .., : ., , . , .22
  • : 04.01.1959 .., : , , , 50.
  • : : www.ok.ru+ , id : 27724372,
  • Safsa Asfsa: : www.ok.ru+Safsa Asfsa, id : 73824625,
  • : 05.07.1956 .., : , . .15 .3
  • : 6.5 .., - .., : www.vk.com/id220049699.
  • : .: 8 (921) 7255774, 337152, 337152, : , 72
  • : 25.11.1968 .., : , .65 .1
  • : . .: 8 9065263581, : . - 1
  • : 29.01.1992 .., : - / . -
  • : , . . 38, . (495) 2467796.
  • : 31.07.2001 .., : , ., 11
  • : 06.07.1947 .., : 454. : .
  • : 27.10 .., : www.vk.com/id220513849.
  • : 14.11.1967 .., , . . 14, . (495) 4553605.
  • MORGUN ALEXANDERMR: : AYT --> -, : -.
  • : 22.06.1960 .., : - 64, . : "".
  • : : , . 37
  • Max Yasser: : www.vk.com/id220949036.
  • : 07.04.1957 .., : ., . 6
  • : .: 89144764859 (), : . (.), . 32
  • : : , . . 5 ,
  • Deleted Deleted: : www.ok.ru+Deleted Deleted, id : 27795227,
  • : 6.10.1996 .., : The Sims 2, - .., : , , , : www.ok.ru+ , : Sticky, Guf, , 5ivesta Family, id : 73687379, : !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!,
  • : 15.03.1938 .,
  • : 2.1.1987 .., : www.ok.ru+ , id : 3199526, : www.master-scep.ru.
  • : 3, , 0, , -1, 5222, 1981 .., : , :
  • : 19.10.1972 .., - .., : www.ok.ru+ , id : 73632443,
  • TAIZHOU City Garments Industry Company XINFU Market: : ZHU,YUEYUAN, : retail garments , textiles , general merchandise , metals equipment ., : , 225300, Jiangsu, Taizhou, No. 5-9, HAILING BEI Road, .: (523) 6224886.
  • : - .., .: 123, : 123, : www.vk.com/id220024145.
  • 18.03.1982 ..: : ., . . .82
  • A: : ., 21013 ( ), - , 1985 .., : , : 1931, 8355935, 4643320, :
  • "" ( ""): .: 02.10.2010 ., : 2635041236, : 1022601961931, : 263501001, : 07401000000, : , : 355002, , , .
  • : 24.03.1937 .., .: (495) 4214696
  • : 27.01.1961 .., : , - 5924788701, , 32, : , 21093, 0245, 2004 .., : Y6D21093040003782.
  • : : www.ok.ru+ , id : 73565072,
  • : 11.04.1947 .., : , - 5623081802, 0, 0, : , 21043, 77371, 1995 .., : XTA210430S0492970.
  • : 13.02.1945 .., : , 432, , ., 13. : "" , : , . 7, .: 24972
  • : 30.9.1982 .., : www.ok.ru+ , id : 73439416,
  • : : www.ok.ru+ , id : 73759479,
  • : - .., : www.ok.ru+ , id : 73084565,
  • : 10.04.1998 .., : ., . , . 43
  • : 20.1.1982 .., - .., : www.ok.ru+ , id : 73090974,
  • : 26.03.1960 .., : ., , , 9.
  • : 08.09.1983 .., : .
  • : : , . . 43 . 2 . . 43 . 2 . . 43 . 2, . (495) 3313556.
  • : 14.06.1973 .., : . / \.
  • : 28.02.1957 .., : . . 55, : -3102, 80743, 1997 .., XTH310200V0063588.
  • : : barbie19.03@mail.ru
  • : : www.ok.ru+ , id : 73487527,
  • : : www.ok.ru+ , id : 73251607,
  • : 15021976 .., : ., 50 .17, : 21102, 69664, 2003 .., : XTA21102030560295.
  • : - - .., .: 89294744123, : www.vk.com/id146743765.
  • : - - .., .: samsung, : www.vk.com/id220702258.
  • ² : 25.07.1953 .., : , - 5640700000, , 10., : OPEL, ASKONA, 11584, 1988 .., : WOL000086J1192251.
  • : 20.06.1938 .., : ., .1
  • : : www.ok.ru+ , id : 73441096,
  • : 27.8 .., : , .: 09716367**, : www.ok.ru+ , id : 73743962,
  • : 3.9 .., : www.vk.com/id220767049.
  • : 08.04.1961 .., : , , . ., . 20-, 20.
  • : 01.01.1959 .., : ., . -, 31
  • : 25.12.1943 .., : 21099, -, 49352, XTA21099033424684, 2003 .., : , . 37
  • : 20.12.1941 .., : , . . 15, .: (495) 2682031
  • : : www.vk.com/id220311476.
  • : 18.6 .., - .., : www.ok.ru+ , id : 73654155,
  • Vadsigaard Vedsige: 1.4.1999 .., .: 0497532812, : www.vk.com/id221171044.
  • : .: 8 9510033513, : , 50 , -, 3
  • : : www.vk.com/id146929232.
  • A: : ., 21043 ( ) , - -, 1996 .., : , : 87340, 2103-4432206, 0567534, XTA210430V0567534, :
  • : : (495) 2917958.
  • : : www.vk.com/id220181893.
  • : 08.07.1939 .., : , , , 4
  • : 24.06.1935 .., . , . .20 .1
  • : 08.08.1967 .., : LADA 210740, -., 965152, XTA210740BY021416, 2011 .., : , 6
  • : 1952.09.20 .., : ., -, , , 303, : 311000, , 34436, 1999 ..
  • ѲͲ : : 3104918714, 03.01.1985 .., ʲ - .., : , ʲ
  • : : www.ok.ru+ , id : 3247537,
  • : 01.01.1900 .., : , - 5924450100, Ѳ, 60, : , 3, 9336, 1980 .., : 0.
  • : 29.01.2004 .., : ,
  • : 19.01.1972 .., : , . .23 .1
  • в : : 3171111652, 27.10.1986 .., - .., : ,
  • I I: .: 80473795116, 80472540482, +380673466033, : , , I, . , . , . 12
  • : : www.vk.com/id220288457.
  • : 10.11.1985 .., : www.vk.com/id220839715.
  • : 26.10.1948 .., : , . .42
  • Garcia Diaz Tomas: : 28030, Madrid, .: +34 914.399.384
  • : 1.8.1982 .., : www.vk.com/id220786778.
  • : 19.05.1961 .., : , . . 11 . 3, .: (495) 3080503
  • Mozolyuk : 13.12.1992 .., : |, .: 111111111111111111111111, : www.ok.ru+Mozolyuk , id : 27804284, : http://vkontakte.ru/andrey_mozolyuk.
  • : 23.10.1975 .., - .., : www.vk.com/id146816389.
  • : : 2875720937, 25.09.1978 .., в - .., : , в
  • : : , , : shokurov91@mail.ru
  • : .: 0505562***, : www.ok.ru+ , id : 73804546, : ,????????!!!!!!!!.
  • : 15.11.1959 .., , . . 8 . 2, . (495) 2164343.
  • : 2.3 .., : www.vk.com/id220657542.
  • : 05.01.1977 .., .: 9095958583 (), : , 162390, . , . , .14
  • Crihtiaho Rohaldo: : www.ok.ru+Crihtiaho Rohaldo, id : 73541557,
  • : 29.10 .., : www.vk.com/id220573371.
  • : 28.07.1962 .., : ., , . , , .47
  • : 19.06.1943 .., : , . .2
  • Elfar Ahmed: : www.vk.com/id220956820.
  • : - .., : www.vk.com/id146847588.
  • : 03.10.1972 .., : , . . 21, .: (495) 3228674
  • : : , 24, .: 8 (3452) 693945.
  • : 28.03.1997 .., : ., -, . , . 33
  • : : www.ok.ru+ , id : 73150193,
  • : 16.12 .., : www.vk.com/id146730255.
  • : : www.vk.com/id221134067.
  • : : doom, : www.ok.ru+ , id : 73538925,
  • : : www.vk.com/id220469091.
  • " " ( " "): .: 12.07.2013 ., : 6234013831, : 1056204016681, : 623401001, : 61401000000, : , : 390000, , , , 16.
  • : 14.10.1982 .., : . / .
  • : 07.02.1930 .., : ., ., ., .25
  • WUXI City Adult Education Association: : SUN,CHANGJI, : research , science, : , 214021, Jiangsu, Wuxi, No. 119, XINMIN Road, .: (510) 2701377.
  • : 13.4 .., : , .: 123456789900, : www.ok.ru+ , id : 73093852,
  • : . , . . .11 .1
  • : 23.08.1974 .., : , - , , 8 2.
  • : 07.09.1976 .., : - , .
  • : . , . .11 .1
  • Wuxi SHANHE Group Health Ginseng medicine Chain Co.,ltd. TAIHU Garden Drugstore: : LI,KAIGUO, : western medicine preparation , traditional patent medicine , ginseng and antler traditional chinses medicine , physic , tonic health care medicine, : , 214028, Jiangsu, Wuxi, No. 248, TAIHU Garden, .: 2200464.
  • : 17.05.1975 .., : , , , 18
  • : 8.1 .., - .., .: 89603049591, : , : www.vk.com/id220908099.
  • : 6.2.1987 .., : www.ok.ru+ , id : 73421961,
  • : 18.10.1958 .., : ., . , .: 8 (812) 0025778, : , 21747, 1991 .., : WFONXXGBBNMC97309, MC97309.
  • - : : www.vk.com/id220020889.
  • : .: 89069269216 (), : 652640 . . 17
  • JIANGDU City KAIYUANKE Freight Rent Service Center: : GU,SHICHUAN, : freight service (society bus & ship , automobile rent , transport service), : , 225211, Jiangsu, Yangzhou, No. 1, CHEZHAN DONG Road, DAQIAO Town, .: (514) 6443888.
  • : 01.01.1951 .., : ., , , 10.
  • : : www.ok.ru+ , id : 73643651,
  • : 24.10.1988 .., : , . . 50, .: (495) 3098745
  • : : www.ok.ru+ , id : 73792301,
  • : : www.vk.com/id220616618.
  • : 02.03.1953 .., . , 7- . .33 .5
  • : 6.4.1994 .., - -- - .., : www.ok.ru+ , id : 73490844,
  • : TOYOTA VISTA, (), , 14, 14, 257407, 1998 .., : , :
  • : 18.3.1999 .., - .., : www.vk.com/id220075311.
  • Ads Ads: : www.ok.ru+Ads Ads, id : 73176204,
  • : 21.6.1993 .., - - .., : www.vk.com/id219988217.
  • : 11.11.1944 .., : , . .17/2
  • : : www.vk.com/id220568093.
  • : : Main Event, : www.ok.ru+ , id : 3067919,
  • : : www.vk.com/id146584565.
  • : 27.06.1995 .., : . -1, , 4. : , 680000 . . ,56,
  • . .: : , , , 66, .: (86/) 255856.
  • Corrales Varona Miguel: .: 32240538, : , J.Rodriguez 353 21AvellanedaOwen
  • : 8.4.1985 .., - .., : cargo_transport, : www.ok.ru+ , id : 3249466, : www.gramhost.lv www.domenx.ru.
  • : 19.04.1985 .., : ., . -, 7
  • : 02.12.1975 .., : 443112, , , , , , 24\9, : 21140, , - , 55563, 21140074307947, 4307947, 4498728, 2006 ..
  • : 14.07.1979 .., : / .
  • : 20.12.85 .., : , , . , ., 110
  • : 20.01.1936 .., , . . 7, . (495) 4931918.
  • : 24.5.1995 .., : World of tanks, Minecraft, CS, - .., : 2033 , , .: , : 1-2 , , , , , : maksis92, : www.ok.ru+ , : , : RED HOT CHILI PEPPERS, Three Days Grace, SlipKnot, Raunchy, Sonic Syndicate, AC DC, , Nirvana, ColdPlay, Gorillaz, Sum 41, Skillet, Linkin Park, Green Day, Bullet For My Valentine, Fall Out Boys, EGYPT CENTRAL, System of a Down, Pendulum, Klaypex, Celldweller, Blue Stahli, Noize MC, LMFAO, Dj Jazz, Skrillex, Marlyn Manson, Fireflight, Swedish House Mafia, Rammstein, Tiesto, Of Mice and Men, Sleeping With Sirens, Deadmau5, The Subways, White Stripes, Destroy Rebuild Until God Shows, The Offspring, Yellowcard, NewTone, Hans Zimmer, Theory Of A Dead Man, Good Charlotte, Bring Me The Horizon, Thousand Foot Krutch, Muse, Prodigy, id : 73402955, : , , , hi-tech,
  • : .: 8 (812) 159-72-30, .: 9131850 (Tele2), : , -, 78
  • : 5.3.1996 .., : www.ok.ru+ , id : 73838528, : http://sprashivai.ru/TatelL.
  • : : www.vk.com/id220364020.
  • : .: 8 (342) 552387, : . , , 10
  • : : 3024120119, 18.10.1982 .., - .., : , в
  • : 5.3.1985 .., : www.vk.com/id221095554.
  • : TOYOTA CARINA, (), , 14, 14, 94825, 1990 .., : , :
  • : : www.vk.com/id220097477.
  • : : www.vk.com/id220122453.
  • Schovsbo Signe: : www.ok.ru+Schovsbo Signe, id : 27977789,
  • : 05.11.1919 .., : ., . -, 76
  • : 21.05.1950 .., : , , ., -, ., ., 35, : 8284, -, 764363, VF8284000000697, 0000697, 1999 ..
  • : 25.08.1945 .., , . . 17, . (495) 1145087.
  • : : www.ok.ru+ , id : 73579817,
  • : : 1014611315, 12.10.1927 .., ϲʲ - .., : , Ѫ
  • : 12.02.1941 .., : , , , 36
  • : , . . 42/44 ,
  • : 03.08.1931 .., . , ., .2
  • : 22.09.1931 .., : ., . -, 7
  • ... Ant: : www.ok.ru+... Ant, id : 73224622,
  • : 03.07.1953 .., :
  • : ..: 8 9053155936, : , 422000 . . 18
  • : 25.04.1983 .., : , . .49
  • : .: 8 9089619294, : , , , 31
  • U6868 756856: : www.ok.ru+U6868 756856, id : 73215226,
  • : 19.01.1963 .., : - , ., ., 3
  • : 03.07.1958 .., : , , , 3
  • : .: 89066711129 (), : ., . . 10
  • Lacroix Remy: : www.vk.com/id220177583.
  • : .: 89144627995 (), : . (.), . 6
  • : - .., : xeniyaromantika, : www.vk.com/id146732008.
  • : 14.08.1927 .., . H H - .., : (.: 27.02.2002 H .H) 1, .
  • : : www.ok.ru+ , id : 73301332,
  • : : , , 22.05.1992 .. .4
  • Secret Victoria: : www.vk.com/id220391773.
  • : .: 8 9502874071, : , , , 56
  • : : , . . 8 . 3, . (495) 3756791.
  • : : , . .22 .2
  • : 5.12.1992 .., : Racer, : www.ok.ru+ , id : 27897330,
  • JIANGYIN City West Suburb XIYUAN Advertise Decoration Trading co.: : XU,PING, : typing , photocopy , oil painting, : , 214400, Jiangsu, Wuxi, No. 35, RENMIN XI Road, .: (510) 6112706.
  • : 02.03.1984 .., : ., --, , 44.
  • : 03.07.1986 .., : , 1
  • : 25.05.1927 .., : , ,
  • : : 1315828277, 10.01.1936 .., - .., : , ֲ
  • : 06.03.1960 .., . (495) 5565857.
  • -13: 28.08.1927 .., : , . .8 .2
  • : : www.ok.ru+ , id : 73692041,
  • : : www.vk.com/id220362866.
  • : 6.9 .., .: 7953936****,7911672****, : www.vk.com/id146501746.
  • : 21.08.1946 - .., : HYUNDAI, ACCENT, , 58256, 2004 .., : . .47
  • : 08.08.1993 - .., : .-, . . 71
  • : - " "-". : , 39. : 122-21-00, 122-21-00. : 84600 .
  • : 29.03.1983 .., : /
  • : .: 89036563030 (), : ., 17 253
  • : : www.vk.com/id220367403.
  • : 3.1.1967 .., - .., : www.ok.ru+ , id : 73621916,
  • : 19.2.1997 .., .: 0959215443, : www.vk.com/id221199702.
  • : 6.5 .., : www.ok.ru+ , id : 3123694,
  • Lira Irene: : www.vk.com/id221064823.
  • : 01.02.25 .., : , , . , . 2-, 40
  • : 24.7 .., ! - .., .: soni, : ??, : www.vk.com/id221208697.
  • : .: 89035794927 - , . - . . - 38. , , , :) . ( , Basconi, , , , : > : 38, : 1500 .), : , .
  • : 1963.02.20 .., : ., -, , 2, : 2106, , 00536, , 1978 ..
  • : : 2961921752, 03.02.1981 .., - .., : ,
  • : 13.5 .., : www.ok.ru+ , id : 73488942,
  • : : www.vk.com/id146706771.
  • : 19.09.1925 .., , . . . 3, . (495) 4917915.
  • : : www.vk.com/id220281791.
  • : 21.05.1998 .., : , ., 5
  • : : www.vk.com/id220900857.
  • : 2.7.1999 .., : www.vk.com/id221024162.
  • : : , : Polya_R9669@gmail.com
  • : : www.ok.ru+ , id : 3271439,
  • : : www.vk.com/id220990693.
  • Parra Ilse: : www.vk.com/id220994237.
  • Ͳ в : : 3075621690, 16.03.1984 .., ʲ - .., : ,
  • ..: , . . 9 ,
  • : : www.ok.ru+ , id : 73445609,
  • : .: 8 9027037104, : , , , 2
  • : - .., : www.ok.ru+ , id : 3264237,
  • : 01.01.1900 .., : , - 5924785001, 0, : , 2140, 2954, 1976 .., : 0, 12242.
  • Bieber Justin: 1.3.1994 .., .: ? Iphone, : thejustindb, : www.vk.com/id220878663.
  • : .: 89144846667 (), : . (.), , ,
  • Korkina Marina: : www.ok.ru+Korkina Marina, id : 73651751,
  • : 02.11.65 .., : , , -., 362
  • FRESHWATER FISH MARKETING CORP - , : 1199 PLESSIS ROAD WINNIPEG MANITOBA R2C3L4, : "", : 197342, ., -, . , .64, .1, , . 6-, : - 3467405, : (COREGONUS CLUPEAFORMIS) , , ب. : 1250-1800 / 255 , 8670 , 9292,5 - FRESHWATER FISH MARKETING CORP-WPG (1664)
  • : 29.06.1982 .., : , , , 1. : - ""
  • : .: 89629861669 - 2- 68.. 4- 22- . , . 10, 4 . -, 2002 . 68 . . - 18.1/15.8 .., 11,6 . ., . ., 5 .. ( 2 . ), - 3. . 3- . . . (, 2- , 68 .., 4/22 ., , 2- 68 .. 4 22- , : 15500000 .), : , . , , 223
  • : 9.3.1981 .., : www.vk.com/id220370899.
  • : .: 8 4232264181, : , , 37
  • : : www.ok.ru+ , id : 73216378,
  • : 19.05.1986 .., : ., . -, 6
  • : 25.7.1997 .., *) - .., : www.vk.com/id220060372.
  • : : ., 163026, , , 116, .: 8 (8182) 293612377.
  • : : 1364821150, 14.05.1937 .., ʲ - .., : , ²
  • : : www.ok.ru+ , id : 73782643, : http://loveplanet.ru/a-main/pol-1/spol-2/bage-18/tage-25/foto-1/country-3159/affiliate_id-45306/track-v73782643/online-1/sid-b0221b0f49d4249158f04fcc993dbe26/.
  • : : ˸, - .., : www.ok.ru+ , id : 3106829,
  • : : www.vk.com/id146569315.
  • : : www.vk.com/id146860625.
  • : 30.12.1965 .., : 21061, 01902, , 1981 .., : 0506332, 4983456, : , , , 64.
  • : : www.ok.ru+ , id : 73651923,
  • ..: , . . 22 ,
  • : 11.02.1945 .., : , .1006
  • : : StreetRACER, : www.ok.ru+ , id : 73242899,
  • : 24.09.1979 - .., : , 469, , 03256, 79 .., :
  • : : www.vk.com/id220624367.
  • : : www.vk.com/id220775491.
  • : : www.vk.com/id146478302.
  • : Theydon Bois Lawn Tennis Club, 9261, Sports, Leisure, Entertainment, Sports Clubs & Associations, : , , Theydon Bois, Sidney Road, Epping, Essex, Eastern, CM16 7DT, CM16 7DT, Eastern, Essex, Epping, .: 441992814044, : Mr Eric Ringwood (Chairman)
  • : 19.04.1961 .., : .,..
  • : 13.09.1973 .., .., : 425200 - . . 3, : 1215043856,
  • ò: : 3086623915, 04.07.1984 .., - .., : ,
  • : .: , : www.ok.ru+ , id : 73216751, : .
  • : 20.11.1998 .., : , .13
  • : 10.07.1975 .., : , , ., -, ., -, 15, : 21102, -, 75163 *, 2110200202452, 0202452, 0127591, 2000 ..
  • Stark Johnnie: 12.9.1996 .., - .., : www.vk.com/id221015691.
  • : 20.11.1968 .., : 446200, , , , , -, 21, : 96742, , , 400063 *, 1F9674210000095, 0000095, 2001 ..
  • Pennings P G: .: 243581948, : , , 6581AZ, Malden, Valkenier, 5.
  • : 12.12 .., - .., : www.ok.ru+ , id : 3264874,
  • : : www.ok.ru+ , id : 73651513,
  • : 27.06.1985 .., , . . 4 . . 4, . (495) 3210142.
  • Ѳ ² : : 2610720916, 24.06.1971 .., Ѳ - .., : , Ѳ
  • : : www.ok.ru+ , id : 27956144,
  • : : www.vk.com/id220168198.
  • : 21.02.1969 .., H . H - .., : (.: 01.02.2002 -H . H) 21, .
  • : 7.11.1994 .., : www.vk.com/id220997547.
  • : : www.vk.com/id220024098.
  • Vergnas Alexandra: : www.vk.com/id220917808.
  • : 7.11 .., : www.ok.ru+ , id : 27717405,
  • : 22.02.1985 .., : , 12- . .4 .1
  • : 31.10.1947 .., : , . .5
  • Varhavsky Artem: 10.7.1993 .., : !1!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!11111111111111111111111111, : Sancho, : ˲!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! !, - .., : !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!, .: !!&,#33, : 䳿, , : www.ok.ru+Varhavsky Artem, : , , , Ͳ, , , !, : !!!!!!!!!!!!!!!!!!!!!! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!, id : 73556377, : , , !!!, : .
  • : 5.7 .., : www.ok.ru+ , id : 73733232,
  • : 19.06.1918 .., H . -H H H H - .., : (.: 10.06.1976 . H) 97, .
  • : .: 9215126067, 81531 9, 81531 9, : ., , 46; : ., , 46
  • : 1922 .., : . , , , 19.
  • v?? : 20.1.1989 .., : www.ok.ru+v?? , id : 27763911,
  • : : www.vk.com/id220819357.
  • : 26.09.1979 .., : ., . -, 7
  • Suhih Dianochka: 1.4.1994 .., : .... , : **LGL**, : ..., - .., : , ... ....., : ...., : www.ok.ru+Suhih Dianochka, : , : .... ....))))))), id : 27905664, : , ..... ....)..... .... ...,
  • : 09.03.1987 .., : , , , /, ., 160
  • : : www.vk.com/id220515059.
  • " " ( " "): .: 28.06.2013 ., : 3528175501, : 1113528001047, : 352801001, : 05401376000, : ( .), : 690091, , , , 12.
  • ˲ : : 3425202197, 11.10.1993 .., Ͳ - .., : , Ͳ
  • : 20.07.1934 - .., : , 1907000, 1907244, , , 29, : 412, , 2227, 0421229, 1983 ..
  • : : 3140714338, 27.12.1985 .., - .., : ,
  • : : www.ok.ru+ , id : 73821815,
  • : 01.01.1927 .., , . . 7, . (495) 1726512.
  • : : www.ok.ru+ , id : 73224395,
  • Lenkoranskiy Aqa: 9.9 .., Lenkoran - .., .: +7902281**98, : , : www.vk.com/id220452452.
  • : : max301294@yandex.ru
  • : : www.vk.com/id221065101.
  • : : www.ok.ru+ , id : 73366300,
  • : : www.ok.ru+ , id : 73627389,
  • : 28.08.1960 .., :
  • : 29.01.1963 .., : , . .9 .5
  • : : www.ok.ru+ , id : 73642912,
  • : : www.vk.com/id220325639.
  • : 3.8.1989 .., : www.vk.com/id220179042.
  • : : , , , : , , - .., : , , .: , : , : www.ok.ru+ , : , : , , , id : 73851834, : ____________mMoooooooM8888 ______________MogggooooooM88888 ________MMMMMoooooooooooM8888888 ________M6ooooMMMmoooooooM888888888 _____Mmooo8oooooooooooooM88888888888 ____MmmmooooooooooooooM88888888888888 ___Moooooooooo8888888M8888888888888888 __Mooooooooooooo88888M88888888888888888 ___MmooooooooooooooommM88888888888888888 _______M88ooooo888mooMM88888888888888888 ________M88888888oommooM88888888888888888 _________M888888ooooMM8888888888888888888 _________MooooooooooM888888888888888888888 ______888MoooooooooM8888888888888888888888 ___888888MooooooooM88888888888888888888888 __88888888MoooooooM8888888888mmmm888888888 _888888888Mo8oooooM8888888MooooooooM888888 8888888888Moo8oooM8888MM8ooooooooooooM88888 8888888888Mooo88ooooM888MoooooooooooooM8888 _M8o8888ooo8oo88ooo0ooMMoo888oooooooooooM88 Mooo88888ooo8o88o8oooooooooo8888oooooooooM8 Moo8888o8ooooo8ooooooooooooooo8888ooooooooM8 Mooo88oooooooooooooooooooooooo888888oooooooM8 Mooooooooooooooooooooooooooooo88888888ooooooM8 _MooMooooooooooooooooooooooooooM888ooo88oooooM __Mmoooooooooooooooooooooooooo888Moooo8oooooooM ___Moooooooooo8oooooooooooooo8888MMooooooooooooM ____Moooooooo88ooooooooooooo88888MMM8oooooooooooM ____Moooooooo88oooooooooooooo88888MMMMoooooooooooM ____Moooooooo88Moooooooooooooooo88888MMMMoooooooooM ___Mooooooooo88Moooooooooooooooo8MooooMMMMoooooooooM __Mooooooooo8MMooooooooooooooo88MoooooMMMMooooooooooM _Mooooooooo88MMoom888mooooooo88MooooooMM_MMoooooooooo _M8moooooo888MMoom@@8moooo8888M8oooooooMM__MMooooooo M@88moooo888MooMom8@8mooo8888MooooooooMM___Mmoooooo0 _*M8mooo8888MooooMm8mooo888M888ooooooooMM___Moooooo00 ____MMMMMM8888oooooMMmmmmM88888oooooooMM_Moooooooo0 __________M88Moooooo8888888888oooooooooooMMoooooooooo __________M88Mooooo8o888888888ooooooooooooMoooooooo88 ___________M88Mooooo8ooo888888oooooooooooMooooooo8888 ____________M888Mooo888ooooo888ooooooooooMoooooo8888M ____________M88888Moo888oooooo8888ooooooMooooooo888M8 _____________M888888Mo8888oooooo8888oooMooooooo888M88 ______________M8888888Mo8888ooooooooooMoooooooo88M888 ________________M888888M88888oooooooooMoooooooo8M8888 _________________M8oo888M888888ooooooMoooooooo8M88888 __________________M8ooooMM88888888ooMooooooooM8888ooo ___________________MooooM_M88888888MooooooooM888ooooo ____________________MooooM_M888888Mooooooo8M88**ooooo _____________________MooooM_mmmmmmMoooooo8Mmooooooooo ______________________MoooQooommmmMoooMMooooooooooooo _____________________MM88ooo8ooooMMMooooooooooooooooo __________________mM8888M88o88mMmoooooooooooooooooooo ____________mMMMoooooooooM888Mmoooooooooooooooooooooo _______MMMMoooooooooooooooMMooooooooooooooooooooooooo ___MMMoooooooooooooooooMMoooooooooooooooooooooooooooo MMMooooooooooooooooooMMooooooooooooooooooooooooooooo8 oooooooooooooooooooMMooooooooooooooooooooooooooooo888 oooooooooooooooooMMooooooooooooooooooooooooooo8888888 oooooooooooooooMMoooooooooooooooooooooooooo8888888888 oooooooooooooMooooooooooooooooooooooooooo88888888888M ooooooooooooMooooooooooooooooooooooooo8888888888M____ oooooooo88Mooooooooooooooooooooooo88888888888M_______ oo8888888Mooooooooooooooooooooo888888MMMMMMMMMMMM888 8888MMMMMooooooooooooooooooooo8888M888888888888888888 8MMM888Moooooooooooooooooooo88M8ooooooooooo8888888888 88oooooMoooooooooooooooooooMMooooo,
  • : 01.01.1900 .., : , - 5940200000, ., 6, : , 968, 3336, 1985 .., : 968M789344.
  • 01.06.1962 ..: : ., . .17
  • : 12.04.1934 .., : ., . -, 25
  • : 11.5.1988 .., : www.vk.com/id220282574.
  • : 17.10.1996 .., - .., .: 89135217155, : www.vk.com/id146589859.
  • : 17.11.1951 .., : , . . 27, .: (495) 1382926
  • Uhbymrj Vbif: : www.vk.com/id220803557.
  • .: : , 3- . . 3 ,
  • Poyraz Tamer: 1.3.1987 .., : www.vk.com/id220628355.
  • : 1977 .., : ., , ., , 80
  • Mir Ale: : www.vk.com/id220767256.
  • : : www.ok.ru+ , id : 73323746,
  • : - .., : www.ok.ru+ , id : 73337954,
  • : 18.1 .., - .., : www.vk.com/id220699860.
  • : 02.03.1980 .., , . . 28, . (495) 1466438.
  • Smit R P: .: 464758264, : , , 6166JB, Geleen, Gansbeek, 38.
  • : 30.07.1977 .., : -2 ., : ., .38
  • "" - "": , : 840000 ., : - , : 0, : 46264891, : , , , : 187026, 187026.
  • : 20.08.1924 .., . , - . .4
  • JIANGYAN City XINCHENG Electric appliance Factory: : WANG,ZHENGYU, : low voltage electrical equipment components manufacturing, : , 225500, Jiangsu, Taizhou, ZHAIJIA Village, JIANGYAN Town, .: (523) 8522009.
  • ˲ ò : : 2228724110, 07.01.1961 .., - .., : , ²
  • : : , , , 80
  • : , . . 12 ,
  • KHAYBULAEV MAGOMEDKHABIB: : SAW --> , : Kabo Air.
  • : 2.9 .., - .., : www.vk.com/id220890038.
  • : 13.7.1982 .., : www.ok.ru+ , id : 73406153,
  • : 24.1 .., : , : www.ok.ru+ , id : 3084065,
  • Ͳ в: : 3095719939, 03.10.1984 .., - .., : , '
  • : .: 8 9066490403, : . . -
  • : 10.06.1926 .., : ., . -, 6
  • : : www.vk.com/id220746858.
  • : 01.02.1937 .., . , . .13/10
  • Zymler Rafael: 6.11.1990 .., : www.vk.com/id220585209.
  • : 26.09.1953 .., , . . 67 . 3, . (495) 1285989.
  • : 12.04.1952 .., : , , , 1. : 1, : 6.
  • : . - - .., : , - "" . ,
  • : 08.09.1975 .., : , . .54
  • : : www.ok.ru+ , id : 73407734,
  • : 26.08.1936 .., : , , , .7-9
  • Kapriz Miss: : www.vk.com/id220661838.
  • : 16.05.1975 .., : ., . -, 3
  • : 25.07.1964 .., : , .
  • : 18.10.1940 .., : ., -, . , . 6
  • : : www.vk.com/id220145891.
  • : 23.10.1937 .., : ., . -, 26
  • : : , : , : , : www.ok.ru+ , : , id : 27823970,
  • : : www.ok.ru+ , id : 73064687,
  • Ҳ : : 2755721576, 13.06.1975 .., ʲ˲ - .., : ,
  • : .: 8 9089748691, : , , , 27
  • ˲: : 3072419379, 13.02.1984 .., .ȯ - .., : , .ȯ
  • : : www.ok.ru+ , id : 73854794,
  • : : www.ok.ru+ , id : 3288499,
  • : 31.05.2000 .., : ., : , .
  • : : 3700600497, 26.04.2001 .., ʲ - .., : , ʲ
  • Fsdfsadf Dfasd: : www.ok.ru+Fsdfsadf Dfasd, id : 73578459,
  • : 18.02.1950 .., : , . . 3, .: (495) 3284252
  • Dima: : www.ok.ru+ Dima, id : 73712808,
  • : : www.vk.com/id221124642.
  • : : www.vk.com/id220175313.
  • : 1.6 .., - .., : www.vk.com/id220820821.
  • : : ?, : ?, : ?, .: 89091912949, : ?, : www.ok.ru+ , : ?, : ?, id : 73846996, : ?,
  • : 03.03.1928 .., : 2102, 2834, , 1980 .., : 0431090, 4676837, : , ...
  • IJ: : 3587701032, 24.03.1998 .., ʲ - .., : , ʲ
  • : 6.6 .., : www.ok.ru+ , id : 73091576, : ask.fm/yuliyakolesnichenko.
  • : - .., : www.vk.com/id146914400.
  • : : , , !!!, : , Gansta, - .., : , .: , : old cinema - new cinema, : www.ok.ru+ , : :), : , , Le arestantz, N.U.K, Mad Bustazz, , Marselle, ()., id : 73214811, : :), : .
  • 16.09.1959 ..: : ., . .40
  • : : , : lena.rogozhkina@mail.ru
  • Suzhou ZHONGHANG Industry & trade Co.,ltd. Pure water Branch: : YANG,DEMAO, : manufactory marketing pure water, : , 215001, Jiangsu, Suzhou, No. 60, BEIYUAN Road, .: (512) 7536622.
  • : 22.04.1962 .. : . : - " "
  • : 10.07.1982 .., : 666703, , . , , 14
  • : 16.03.1969 .., : ., , .
  • : : www.arena.ru, - .., : www.ok.ru+ , : , id : 73583082, : . archery,
  • - : : www.vk.com/id220887507.
  • ² в: : 2196623659, 21.02.1960 .., . - .., : , .ȯ
  • ò: : 3309810238, 14.08.1990 .., - .., : ,
  • : 13.5 .., : www.vk.com/id146655764.
  • Egorov Gena: .: 89506029043, : www.ok.ru+Egorov Gena, id : 73473683,
  • : 25.12.1955 .., : 21011, , 992152, OTCYTCTBYET, 1975 .., : , 22
  • : 01.01.1956 .., : , . . 1 . 3, .: (495) 4225713
  • ˲ : : 3265408711, 27.05.1989 .., - .., : ,
  • : 21.01.1984 .., : , , , ., 12. : , : , 45, .: 311271
  • : 11.2 .., : www.ok.ru+ , id : 3211457,
  • : 13.10.1980 .., : , : .,
  • : 29.09.1926 .., : , ., , 8
  • : : ., . -, 20
  • '²' : : , - 5925050100, 0, : IVECO, EUROCARGO, 1890Ѳ, 1998 .., : 0, ZCFA1LLH002264017.
  • : 02.12.1972 .., : , , , 6
  • : 11.12.1957 .., :
  • : 13.08.1948 .., : . -, -, ., 10
  • Le Daisy: .: 84916527272, : yennhi138, : www.vk.com/id220793019.
  • : 15.09.1933 .., . , .20
  • : 20.10.1987 .., , . - .., : 160
  • : 29.01.1965 .., : . -, -, ., 25
  • : . .: 8 9050779028, : . . 45 44
  • : 02.11.1976 .., : , ., . .11
  • : .: +380668525323, : , .
  • XISHAN City HOUQIAO Construction Engineering Unit: : PU,MINTAO, : , 214106, Jiangsu, Wuxi, DONGJIE, HOUQIAO Town, .: (510) 87210609.
  • : 12.06.1959 .., : , , ., 113, : 4, 37497, 2004 .., : J20V105001983.
  • TOSHMETOVA OMINA: : --> , : -.
  • : : www.vk.com/id220585811.
  • : 08.10.1951 .., : , , ., 18, : S4, 389199, 2007 .., : TSMEB21S00230737.
  • ϳ : 19.1.1998 .., .: , : www.ok.ru+ϳ , id : 73529865, : .
  • : : 3347806435, 29.08.1991 .., - .., : ,
  • : 18.02.1947 .., , . - . 37, . (495) 4625712.
  • 08.05.1959 ..: : ., .. .34
  • : : www.vk.com/id220951347.
  • : 1.5.1987 .., : www.vk.com/id221177148.
  • : : www.ok.ru+ , id : 73396856,
  • : 7.5.1995 .., : ?DUBA?, : www.ok.ru+ , id : 73215252,
  • Pratchett Terry: : www.vk.com/id221202019.
  • : : , 12, .: 8 (383) 476386.
  • : 22.05.1975 .. : . : " "
  • : 20.02.1959 .., : 214122, 43902, , 1994 .., : 214122S0539690, 0539690, 0396472, 0032755, : , , , 16.
  • : 06.07.1958 .., : * * , : ., .16/4
  • : 19.02.1921 .., . , . .20 .1
  • ..: .: 8-42142-91474, : , , . , 12
  • : 12.12.1904 .., . , - . .11/2
  • : 1924 .., : , .
  • : 1964-12-05 ., .: 79115206323 (), 8172754417, : , . , , 99
  • : 1958 .., : ., , , 1
  • : 22.6 .., : www.ok.ru+ , id : 73262726, : https://twitter.com/aalinyshka.
  • Vanchernko Ledi: - .., : www.vk.com/id146940072.
  • Duzen Ali: : www.vk.com/id220387656.
  • : 30.05.2008 .., : , 6
  • : 21.09.1958 .., : , .
  • : 18.7.1995 .., : www.vk.com/id220101213.
  • : : 2675420317, 01.04.1973 .., - .., : ,
  • : 16.04.1987 .., : - , .
  • : .: +79050602088, +78512477918, : 414004, , , .
  • : : www.vk.com/id220171561.
  • ( ): .: 04.03.2013 ., : 1137746181539, : .2 .21.1 08.08.2001 129-, : 109382, , , 29.
  • : 01.01.1933 .., : ., , .
  • : 12.02.1967 .., : , . .4 .3
  • : : www.ok.ru+ , id : 73606304,
  • : 13.12.1980 .., : www.vk.com/id221066041.
  • : 24.05.2005 .., : ,
  • Surname Name: : www.ok.ru+Surname Name, id : 73810638,
  • : 1.5.1982 .., . - .., .: 89116439239, : www.ok.ru+ , id : 73476355,
  • : : www.vk.com/id220752129.
  • : 01.02.86 .., : , , . , 49, 41
  • : 20.06.1941 .., , . . 4 . . 4, . (495) 1712676.
  • : 20.05.1970 .., , , - .., : 16
  • : 9.9 .., : www.vk.com/id219983492.
  • : - " ". : 26-53-67
  • : 8.4.1993 .., : ***ChOcOlaTe LaDy***, : www.ok.ru+ , id : 73169018, : chocolate lady.
  • : .: 8 (921) 9302170, : -, 4
  • : 4.3.1977 .., : www.ok.ru+ , id : 3095508,
  • : . .: 8 9051372002, : 150010 . . 34
  • : : , , 23.01.1991 .. .
  • ij: : www.vk.com/id220379851.
  • : : www.ok.ru+ , id : 73686746,
  • Gfjsuiuyd Qwencjdh: : www.vk.com/id220476770.
  • : 20.03.1954 .., : , ., -, ., 2, .: (812) 4697195.
  • JIANGYIN City HETANG Town Herding Veterinarian Technology Promoting Station: : WANG,GUIQIN, : , 214417, Jiangsu, Wuxi, HETANG Town, .: (510) 6331621.
  • : 06.01.1989 .., : ., , , .18
  • : 2.4.1982 .., - .., : www.ok.ru+ , id : 3256977,
  • : : , 13- . . 38 . 2 ,
  • : 04.01.1967 .., : , . .12
  • - : 20.10.1986 .., .: +3(097)305..54, : www.ok.ru+- , id : 73830163, : Icq 616-691-691.
  • "-" ( ) - " "-": , : 840000 ., ./: 115-97-54 96883, 115-97-54 96883, : - , : 0, : 46276246, : , : 188900, 188900, 115-97-54 96883.
  • : 01.05.1939 .., : ., . , 8 . 23
  • - "-" ( "-"): .: 20.01.2010 ., : 3805404812, : 1103805000067, : 380501050, : .2 .21.1 08.08.2001 129-, : 665712, , , , 12.
  • : : kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk, : pppppppppppppppppppppppppppppppppppppppppppppppppppppppppp, : llllllllllllllllllllppppppppppppppppppppppppppppppppppppppppppppppppp, : bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb, : www.ok.ru+ , : mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm, : oooooooooooooooooooooooooooooooooooooooooooooooooooooooooo, id : 73759498, : gfffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff,
  • : : www.ok.ru+ , id : 73164345,
  • : 26.06.1963 .., : , .
  • : .: 8 9605353024, : . . 29
  • : .: 8 9024837519, : , , 100--
  • : 07.06.1976 .., . , . .2
  • : 23.07.58 .., : , , 15.
  • : .: 9212865257, 251300, : , ., 28; : , ., 28
  • : 18.10.1935 .., : ., . -, 27
  • : .: +79082522430, +73424329786, : 619430, , -, ,
  • : : www.ok.ru+ , id : 73498340,
  • : 6.5.1999 .., : www.vk.com/id220655023.
  • : 23.06.1957 .., : , . .19
  • : 30.08.1966 .., : , 13
  • : 8.2.1998 .., - .., : www.vk.com/id221208570.
  • : "" ( ""), : , 99045 , . 50 ʲ , .5, . 3, .111, .: , 99045 , . 50 ʲ , .5, . 3, .111, .: в ̲Ͳֲ, 23666256, 15.02.1996 ., : 1) 2140910160, , . 241484, : : 91514 ˲˲ͲͲ : 85.13.0 i , ..: 241484 ..: 448538.
  • : : 3091622173, 23.08.1984 .., - .., : ,
  • : .: 89649560957, : www.vk.com/id221153469.
  • : : www.ok.ru+ , id : 73865617,
  • Fekkes J: .: 332454173, : , , 3862ZR, Nijkerk gld, Vermeerhof, 20.
  • : : www.ok.ru+ , id : 3210855,
  • : : www.ok.ru+ , id : 28050636,
  • : 04.12.1926 .., , . . 70 . . 70, . (495) 3778030.
  • : .: 89601324306 (), : ., 396000, . , . , .15
  • Baas M P: .: 522254610, : , , 7944PT, Meppel, Zwanenbloem, 23.
  • : 21.12.1969 .., : 21061, 66502, , 1991 .., : 2647930, 1853506, : , , , 7.
  • : 11.4.1981 .., - .., : www.vk.com/id220367001.
  • : 30.12.1972 .., : 652645, , -, , , ., . .43
  • : 13.12.1969 .., : . -, -, ., 55, .: (812) 1830655.
  • : 08.03.1941 .., : 412, 33802, , 1976 .., : 545484, 1223005, : , , , 71.
  • : : www.vk.com/id146666611.
  • : 15.10.1973 .., : , ., 58
  • : 21.08.1951 .., : , . .48
  • : 05.10.1958 .., : , -
  • : 15.09.1958 .., : , - .41, 41
  • : .: 8 9059147959, : 652126 . . 2
  • : .: +7 (968) 395-82-98, : , . , 32, .1, : , , , ,
  • : : www.vk.com/id220301523.
  • : , . . 65 . 2, . (495) 4683204.
  • Bedaf M A J: .: 765010877, : , , 4871AL, Vlaanderenstraat, 3.
  • : 18.08.1976 .., : , .40
  • -12 : .: 8-921-7339550 (), 59-56-35,313730, : ., , ., 5
  • : : www.ok.ru+ , id : 27754492,
  • : 08.07.1959 .., . - - .., 1900 .., . - ..
  • : 29.09.1955 .., : , , , .88, .20
  • . : : 54322, 7318, , 1967 .., : , .
  • : 27.04.1932 .., : , . . 3, .: (495) 3540589
  • : 30.06.1956 .., : , : ., .4
  • : : www.vk.com/id220825121.
  • : : 3072520530, 14.02.1984 .., Ѳ - .., : , Ѳ
  • Brg Dmh: : www.vk.com/id220255080.
  • : 28.03.1954 .., : / .
  • CHANGSHU City KEDELI Trading Co.,ltd.: : GU,XUEWEN, : foodstuff mechanical equipment . spare parts and fittings . pipings . food materials marketing, : , 215555, Jiangsu, Suzhou, MOCHENG DONG Street, .: 1396232228.
  • : 11.03.1979 .., : , . .38 .2
  • : : www.vk.com/id220418063.
  • : : www.vk.com/id220238202.
  • Madness Veronika: 30.10.1996 .., : www.vk.com/id220936199.
  • : 6.7.1990 .., : , , !!!!, - - .., : . , :), .: 8(908)515-43-58, : , , ., : www.ok.ru+ , : Comedy Club, : NTL, , , , id : 73085356, : , , ! !!!!!!!!!!! ( ),
  • : 2.3 .., : Jean Paul, .: +37544#######, : www.ok.ru+ , id : 73295649,
  • : 04.06.1949 ..,
  • : 09.04.1926 .., : . . , .., 11
  • : 24.05.1982 .., : ., , . , , .31
  • : 07.12.1982 .., , . . 41 . 2, . (495) 3228686.
  • : : www.ok.ru+ , id : 73545782,
  • : 01.01.1900 .., : , - 5921285201, ., ., : , 412, 3105, 1984 .., : 0593658.
  • : 10.10.1947 .., : , . .7 .2
  • : 14.05.1981 .. : . :
  • Corobco Yuri: : www.vk.com/id220597440.
  • : 26.07.1935 .., - .., : , - 20
  • "- " - "": ,
  • : 06.12.1989 .., : , , , ., 13
  • : 06.10.1926 .., : - 91, . : * , (.).
  • : : , . 12
  • : 22.08.1981 .., : , , -.
  • An: : www.ok.ru+ An, id : 73097854,
  • : 01.01.1961 ..
  • : 4.3.1997 .., : www.ok.ru+ , id : 73229915,
  • : 22.06.1965 .., : 446012, , , : 21065, , -, 66163 *, 2106504094471, 4094471, 5392763, 1998 ..
  • : : www.vk.com/id220304030.
  • : : , 102, .: 8 (831) 424409
  • : 01.06.1926 .., : , , , 305.
  • : : www.vk.com/id221160005.
  • : : www.ok.ru+ , id : 73729737,
  • : - .., : www.ok.ru+ , id : 73870489,
  • Ywfguyrguywgfuwfguwgwf Gdwyudwggdwuywrrrwrw: : www.ok.ru+Ywfguyrguywgfuwfguwgwf Gdwyudwggdwuywrrrwrw, id : 73363084,
  • : ..: 8 9063267891, : , 422530 . . 47
  • : 11.11.1984 .., : , .21 .
  • Burnaeva Natalya: : www.vk.com/id146664739.
  • : : www.vk.com/id220928486.
  • : 04.03.1989 .., : FORD FOCUS, -, 35552, X9F4XXEED45G65220, 2005 .., : , . 57
  • : 09.03.1985 .., : , . .13
  • : - .., : www.vk.com/id146612877.
  • : 22.09.1974 .., : , , , 79.
  • : Tradex: : GB IG1 2RX 199 Ilford Lane Ilford, 199 Ilford Lane GB IG1 2RX Ilford United Kingdom, : 442084782215, http://www.tradexinsurence.co.uk, : Services : 15.
  • : 7.5 .., : www.ok.ru+ , id : 73186353,
  • : : www.vk.com/id221190454.
  • : : , - . .20
  • : : www.vk.com/id146923242.
  • : 10.05.1951 ..
  • : .: 8 9605815455, : 215110, . , . , .0
  • : 11.11.1911 .., : , - 5624287101, 0, 0, : , 11, 5600, 1988 .., : 0, 340595.
  • : 14.7.1981 .., : www.ok.ru+ , id : 3247112,
  • : 19.04.1946 .., : , . . 20, .: (495) 3338576
  • : 22.7.1989 .., : www.vk.com/id220588252.
  • ²Ҳ: : 2647020016, 21.06.1972 .., ʲ - .., : , ʲ
  • : 01.02.96 .., : , , ., 14
  • Senya Senya: : http://vkontakte.ru/id34229393, : www.ok.ru+Senya Senya, id : 73228470,
  • : TOYOTA CORONA, (), , , , 259039, 1989 .., : , :
  • Bondarenko Sergeu: : www.vk.com/id146853643.
  • : - .., : www.vk.com/id146931318.
  • : :
  • ..: , . . 12 ,
  • Sdfsdf Afsdfa: : www.ok.ru+Sdfsdf Afsdfa, id : 73239514,
  • : 28.12 .., : www.vk.com/id220944378.
  • William Peter: : www.vk.com/id219992666.
  • : 01.01.1900 .., : , - 5941000000, , 15, : , 2103, 10967, 1974 .., : 21030156197.
  • : 16.3.1990 .., : www.ok.ru+ , id : 3137349,
  • : 24.03.1984 .., : , ,
  • " "): .: 03.05.2012 ., : 1123926022868, : 27401385000, : .2 .21.1 08.08.2001 129-, : 236022, , , , 21.
  • ˲: : 2029219812, 23.07.1955 .., - .., : ,
  • : : www.ok.ru+ , id : 73498048,
  • : 24.8 .., - .., : www.vk.com/id146667611.
  • : 7.6 .., - .., : www.ok.ru+ , id : 73495991,
  • : .: 8 (3832) 264327, : , , 106
  • : . , - .19
  • Mayola Yannick: kinshasa - .., : films d',action, : www.ok.ru+Mayola Yannick, : hip hop, id : 73166122,
  • Gbdfgb Dfgbdfgb: : www.ok.ru+Gbdfgb Dfgbdfgb, id : 73558335,
  • ..: , . . 35 ,
  • : : , : , : , .: ., : , : www.ok.ru+ , : 6 , : , id : 73388064, : ,
  • : 19.03.1939 .., , 1- . . 5, . (495) 4903479.
  • : 15.12.1947 .., : ., : .. 5262082560, : , .
  • : .: 8 (921) 6491402, -, -
  • ..: , . . 5 ,
  • : : ., : LoBziK_SAN J, - .., .: 8 (985) 912 51 79, : www.ok.ru+ , id : 27724607, : http://www.cjclub.ru/authors/41858.
  • : 19.05.1965 .., . , . 14
  • : : , : www.vk.com/id146712009.
  • : 1977 .., : , .,,55
  • : 25.10.1928 .., . , .32
  • : 10.8 .., : www.vk.com/id146729855.
  • : 15.10.1937 .., : , , , .3, .30
  • : 6.1.1990 .., : www.ok.ru+ , id : 3129493,
  • : : www.ok.ru+ , id : 27718801,
  • : 6.1 .., : www.vk.com/id221128257.
  • 1 : : , : , - .., : , .: 8960*******, : , : www.ok.ru+1 , : , : , id : 73212914, : , : .
  • Rodney Steve: : www.vk.com/id220190488.
  • QIDONG City YONGFA Paper Co.,ltd.: : ZHANG,YONGMING, : stationery . sheet . printing equipment . general merchandises . garments . knitting . plastic products marketing, : , 226200, Jiangsu, Nantong, No. 4, GONGSHANGXIANG, HUILONG Town, .: (513) 3322402.
  • в Ҳ: : 995909033, 08.04.1927 .., - .., : ,
  • : 21.04.1969 .., : , , , 43
  • Ghjjrfgh Fjfgjhgj: : www.ok.ru+Ghjjrfgh Fjfgjhgj, id : 73787123,
  • : 27.11 .., .: Nokia Lumia 710, : www.vk.com/id220214366.
  • : 30.06.1959 .., : , . . 2, .: (495) 4760384
  • " "" - " "": ,
  • : 22.01.1930 .., : , . .51 .4
  • ? : : www.vk.com/id220111635.
  • : ² ̲в (ϲ ²), : , 21000 ², ², . , .36, .: , 21000 ², ², . , .36, 4951, 09.10.1997 ., : 1) 14302590, ² ̲в, : : 97910 : 75.22.0 ii i , ..: 21363 ..: 22691.
  • : : www.ok.ru+ , id : 73384475,
  • Mergalieva Aliya: : www.vk.com/id146484804.
  • : 12.10.1983 .., .: +375444767108, : www.vk.com/id220086693.
  • : , . . . 11 ,
  • : 28.01.1941 .., : ., , , .86
  • : : www.vk.com/id146897708.
  • : .: 89851802158 - YOKOHAMA dB 225\50 R17 98V, (/, 1000 ) - 7,5Jx17H 45. (, 6 2008 . , , : , , : 28000 .), : , .
  • : 25.2.1999 .., : www.vk.com/id220323420.
  • : 5.9.1999 .., : www.vk.com/id146503649.
  • : 7.5.1975 .., : www.vk.com/id221189623.
  • : 12.8.1999 .., -- - .., : kalmikov.artiom, : www.vk.com/id146484789.
  • : : , : super.anita99@yandex.ru
  • : : , . . .9/8 .6
  • : 7.1.1989 .., : -, : www.ok.ru+ , id : 3166294, : http://vk.com/dizayninteryera2.
  • : 16.07.71 .., : , , 5.
  • : 01.01.1910 .., : ., , , 16-.
  • : : www.vk.com/id146552780.
  • : 01051985 .., : ., .20 .79., : ASTRA, 04064, 2008 .., : XUF0AHL088B004564.
  • : : www.ok.ru+ , id : 73760495,
  • : 28.03.1959 .., :
  • : 1939 .., : 72. :
  • : 25.12.1930 .., :
  • : - .., .: 890816125, : www.vk.com/id146561777.
  • : 12.10.1937 .., : , , , ., ., 34
  • 24.02.1947 ..: : ., . .44
  • : 17.8 .., .: 89379386609, : www.vk.com/id220022597.
  • : 9.9.1994 .., : www.vk.com/id221143307.
  • : 10.03.1962 .., : , . .9 .1
  • -1 : : 310290, 32502, -, 40210A, 1993 .., : 3102900125492, 124742, 0125492, 0119643, : , .
  • : 26.08.1967 .., : / .
  • : 10.1.1993 .., : www.vk.com/id146497344.
  • : 07.09.1980 .., : , .
  • : TOYOTA HARRIER, (), , , , 76525, 1999 .., : , :
  • : 07.09.1957 .., , . . 1, . (495) 9487573.
  • : 07101962 .., - .., : - ..
  • : .: 8 (921) 7239831, : , 9
  • http:: : petrikksy@mail.ru
  • "" - "": , : 840000 ., ./: 324-18-13, 324-18-13, : - , : 0, : 46273329, : , : 189710, 189710, 324-18-13.
  • : 17.10.1978 .., : , , , 9. : ""
  • : 01.01.1975 .., : .,
  • : : . . 23, .: 9051393788
  • : - .., : www.vk.com/id146856018.
  • : 21.8.1988 .., : T, , ! - .., .: ., : , ., : www.vk.com/id146550726.
  • : 29.5 .., : www.ok.ru+ , id : 27731035, : http://vk.com/brazhekristinaphoto http://www.mywed.ru/photographer/view/profile/Friduchi/ .
  • : 14.10.1998 .., : www.vk.com/id220951859.
  • : 01.01.1961 .., : (.: 14.05.85 . H) 11, .
  • : 25.07.1947 .., : , . .66
  • Bob Rop: : www.ok.ru+Bob Rop, id : 73546832,
  • : : 1882819893, 20.07.1951 .., вֲ - .., : , в
  • : 12091978 .., - .., : . . .104 .
  • : 15.12.1989 .., : , , ., 296/1
  • : 1923 .., : ., , , , 61
  • ò : : 2913219233, 05.10.1979 .., ʲ - .., : , ʲ
  • ? ?: .: +380662991370, : www.vk.com/id220864157.
  • : : 907807919, 08.11.1924 .., - .., : , '
  • : Hamiltons, 5211, Shops & other Retail Outlets, Grocers, : , , 197 Knightswood Road, Glasgow, Lanarkshire, Scotland, G13 2EX, G13 2EX, Scotland, Lanarkshire, Glasgow, .: 441419591029, : Mr J Hamilton (Proprietor)
  • : 16.06.1956 .., : , . .15 .1
  • в : : 3120318970, 06.06.1985 .., - .., : ,
  • : 10.06.1961 .., : , , , 48
  • Hncgfbgxvfvf Zxdcfvbgnbvcx: : www.ok.ru+Hncgfbgxvfvf Zxdcfvbgnbvcx, id : 73647718,
  • : 13.12.1981 .., - .., : 424000 . - . . 65 . , : 1215099739, ''
  • : M Ajpai, 8512, Other, Doctors, : , , Lewisham Triangle Surgery, 2 Morley Road, London, London, SE13 6DQ, SE13 6DQ, London, London, .: 442083187272
  • : 29.05.1969 .., : . -, -, ., 13, .: (812) 1552962.
  • : : www.ok.ru+ , id : 27789871,
  • : : www.vk.com/id220622514.
  • : 09.01.1993 .., .: (495) 9240447
  • : 07.04.1929 .., : , .
  • : 31.5.1986 .., . - .., : www.ok.ru+ , id : 3278941,
  • : 12.12.1973 .., : www.vk.com/id220797399.
  • : : www.vk.com/id220378245.
  • : 1.10.1965 .., : www.vk.com/id220506203.
  • : 11.11.1958 .., : , 1- . .8/1
  • : .: //////, : www.ok.ru+ , id : 73083704, : ytn*.
  • : 8.5.1964 .., : www.ok.ru+ , id : 73366293,
  • : : www.ok.ru+ , id : 73868737,
  • : : ! !, : , - .., : , : 2, : www.ok.ru+ , : , : , id : 73656908, : ,
  • : 12.01.1953 .., : , , , 8
  • : : www.vk.com/id220413185.
  • : 31.12.1910 .., : , . 9
  • : 13.09.1939 .., : , . . 70 . . 70, .: (495) 1754662
  • : : . , , 11, .: 8 (3472) 393028.
  • : 12.06.1993 .., : ( ), : .,
  • : 27.05.1952 .., : , , , 414. :
  • 10.03.1937 ..: : ., . .58
  • "" - "": , : 840000 ., : - , : 7810140665, : 48938856, : , , , : 196084, 196084.
  • : : 2179722538, 05.09.1959 .., - .., : , Ͳ-
  • "-" ( "-"): .: 30.05.2011 ., : 6829050043, : 1086829009783, : 682901001, : 68401000000, : , : 392036, , , , 11.
  • : 15.8 .., : www.ok.ru+ , id : 73723353,
  • ? : .: 11111, : www.ok.ru+? , id : 73252674, : 1111.
  • : 22.02.1989 .., : ., ., , .47
  • : 10.5 .., - .., : www.ok.ru+ , id : 73430267, : .
  • : 20.9.1988 .., : www.vk.com/id220018555.
  • : 07.08.1952 .., : , . .14 .
  • 22.09.1955 ..: : ., . .24
  • : 27.09.1968 .., : ., , : , 21347, 1985 .., : WOL000033F5150965, 9329583.
  • : 1.1.1948 .., - .., .: , : , , : www.vk.com/id146512707.
  • : 10.07.1950 .., : , . - . .60 2
  • : 1940 .., : 39. :
  • : , . . 5 ,
  • : 23.02.1962 .., : , . .73 .2
  • CHANGZHOU City Suburb WUXING XINGXING Wastrel Purchase Station: : YU,YONG, : subsistence waste paper , plastic waste purchase, : , 213016, Jiangsu, Changzhou, BEI, GONGYE Road, XINXIN Village Party Committee, .: (519) 3268091.
  • : 29.08.1943 .., : , . .7 .1
  • : .: 8 9242548688, : , ; , 16
  • Zerov Zer: 1.1.1979 .., : www.vk.com/id221108271.
  • : 31.08.1928 .., , 3- . . 9 . 3, . (495) 3044374.
  • : 19.11.1990 .., - .., : , PRADA, : www.ok.ru+ , id : 73721011,
  • : The Tool Shed, 5181, Shops & other Retail Outlets, Tool Merchants, : , , 12 The Precinct, South Street, Gosport, Hampshire, South East, PO12 1HA, PO12 1HA, South East, Hampshire, Gosport, .: 442392525075, : Mrs U Moffatt (Proprietor)
  • : : www.ok.ru+ , id : 73364985,
  • : : www.ok.ru+ , id : 73483662,
  • : : www.ok.ru+ , id : 73352044,
  • : 01.02.37 .., : , , . , ., 11
  • в ²: : 3108818713, 11.02.1985 .., - .., : ,
  • : 01.10.1974 .. : . : 113
  • : 10.10.1996 .., - .., .: , : , : www.vk.com/id220841737.
  • : 14.02.1965 .., , . . 17, . (495) 4997773.
  • Minjireanu Cristina: : www.ok.ru+Minjireanu Cristina, id : 73165207,
  • : : www.vk.com/id220415612.
  • : : www.vk.com/id220319303.
  • : 1.11 .., - .., : ))), .: +79210547121, : www.ok.ru+ , id : 73514352, : .
  • : : ... !!!!!!!!!!!!, : , - .., : , .: --, : , : www.ok.ru+ , : , id : 73466447, : , , : http://sekret121.blogspot.com/.
  • : 03.05.1961 .., : , , ., 53
  • : 12.6.1997 .., : www.ok.ru+ , id : 73124264, : http://vkontakte.ru.
  • : : , : _______, : , - .., : , , , , , , : , , , , : www.ok.ru+ , : , : 80, id : 27853607, : , , : -.
  • : : besputina.mariua@yandex.ru
  • : .: 89260586802 - . ! , , . . . . . . . (, , , , , : 80000 .), : , . ,
  • : : www.vk.com/id220897686.
  • Erhan Andrei: 15.6.1999 .., : www.vk.com/id220187082.
  • : 29041969 .., : ., .2, : 21099, 48864, 1997 .., : XTA210990V2161448.
  • Letetov Ricky: : www.vk.com/id220949870.
  • Aleksandrova Evgesha: 1.1.1991 .., : www.vk.com/id146929785.
  • : 01.05.1993 .., . , . .30 .2
  • : : 3059421435, 06.10.1983 .., ʲ - .., : , ʲ
  • : 2.4.1996 .., : , : cs bf GTA4, - .., : , .: 80968008360, : , : www.ok.ru+ , : ...................., : RAP, id : 73455732, : , : tjyyxxt.
  • : - "-89". : 27-86-71. : 10000 .
  • CITY TOWER STORE: : -, (), 58128, Dubai, : 97143322766, : Supermarkets
  • : 05.09.1979 .., . , . .33 .1
  • 123: : www.ok.ru+ 123, id : 73123677, : http://vkontakte.ru/app738755_54096781?ref=1.
  • : 3.2.1993 .., : www.ok.ru+ , : dadashevamn, id : 3150873,
  • : 6.3.1982 .., : , : .., - .., .: 80295779862, : ., : www.ok.ru+ , : , id : 73389596, : ,
  • : .: 8 9146709271, : , ,, 58
  • : 22.11.1957 .., : / .
  • : : , : , - .., : , : , : www.ok.ru+ , : , : , id : 73337937, : ,
  • : 24.01.1981 .., : ., . - - 1 - 960, : , 87178, 1987 .., : WOL000034H2682966, 13HB-1799286.
  • : 15.08.1914 .., : , . .8 .2
  • : : 1395520976, 17.03.1938 .., - .., : ,
  • Anisimov Ruslan: 9.2.1920 .., : , : , - .., : , , , : , : www.ok.ru+Anisimov Ruslan, : , : , id : 27767414, : , : 22222222222222222233333333333333333333333333.
  • : 08.09.1962 .., : , , (-44).
  • : 06.08.1961 .., .., : 425200 - . . .18, : 1215088705, '-'
  • Makhsudov Ahmadbek: : www.vk.com/id220368547.
  • : : www.ok.ru+ , id : 73688366,
  • : 15.10 .., : www.vk.com/id220175703.
  • : 9.12 .., : www.vk.com/id220794096.
  • : 03.07.1966 .., : ., , . , , .8
  • -: 2.7 .., : www.vk.com/id220252177.
  • ( .): 24.01.1959 .., : / 67262 , : . .,1
  • : 22.9 .., : www.ok.ru+ , : ekaterinadurova, id : 3075794,
  • : 30.12 .., : , : !!, .: +375292122336, : , , , , .., : www.ok.ru+ , : , id : 73705503,
  • : : www.vk.com/id220089849.
  • Qeqe Pavekl: 2.4 .., : , : , - .., : , .: , : , : www.ok.ru+Qeqe Pavekl, : , : , id : 73521302, : , : .
  • : : www.ok.ru+ , id : 73533942,
  • "" - "": , : 840000 ., : - , : 0, : 50900157, : , , , : 198218, 000000.
  • : 13.05.1976 .., : , 4
  • : 18.5.1995 .., - .., .: 3809)))))))))))))))))))), : *), : www.vk.com/id220413591.
  • : : www.vk.com/id221171724.
  • Arora Heena: : www.vk.com/id221192394.
  • : 02.02.1966 .., :
  • : 581015 .., - .., : ., , , . 12, : , -, 90135, 1990 ..
  • Shultz Er: : www.vk.com/id220479810.
  • : 1994 .., : , .,,22
  • : : , . . 5 . 2, . (495) 3761738.
  • : : www.vk.com/id220647519.
  • : 07.07.1978 .., : ., , . , , .19
  • : : 2567421778, 17.04.1970 .., Ͳ - .., : , Ͳ
  • : : , 25
  • : 07.08.1976 .., : ., , . , .12
  • ˲: : 3113016698, 25.03.1985 .., - .., : ,
  • : CUBANA, : , , Calle 6 / 1 y 3 Finca El Gallo; ..: 368010100273628, : , Calle 6 / 1 y 3 Finca El Gallo
  • : 08.10.1967 .., : , . .19/12
  • : : www.ok.ru+ , id : 73806817,
  • : 27.01.1986 .., : , . .17
  • : 22.12.1968 .., : , .
  • : 22.08.1980 .., : , 1- . .9
  • - : 10.12.1920 .., : ! ., NEW YORK - .., : !, : www.ok.ru+- , id : 3146493,
  • Kiknadze Guga: : www.vk.com/id220145607.
  • : 19.3 .., : !))))))))) !))))) !))), : nfs-undegraund ))))))))))), - .., : )))))))))))))))))))))))))))))))))))))))))))), .: 897777777777, : .. ., : www.ok.ru+ , : . ., : club/rock/rap/drum and base/.- )))))))))))))))))))))))))))))))))))))), id : 73552777, : )))))), : nemy.ru.
  • : : (), : www.ok.ru+ , id : 73700448,
  • : : 2250922370, 17.08.1961 .., - .., : ,
  • : 17.1.1994 .., - .., : www.vk.com/id220869467.
  • Paimin Frol: : www.ok.ru+Paimin Frol, id : 73114793,
  • : 01.01.1955 .., : ., , , 234.
  • : 24.11.1998 .., : , . .1 .
  • : 26.04.1986 .., : .
  • : .: 8-921-0661927 (), : ., . , 3
  • "": .: 8 (921) 7304208, 8162 642346, 642346, : , .- 115
  • : 30.09.1965 .., :
  • : : www.vk.com/id220592657.
  • ³: : www.ok.ru+ ³, id : 73458173, : vkontakte.ru.
  • ˸: 18.10.1991 .., : ? ?--?, : www.ok.ru+ ˸, id : 28042331,
  • : 24.07.1952 .., : , . .12
  • : 08.06.1951 .., : , ., .35, .1,
  • : .: 89144415146 (), : . (.), .,
  • Wuxi RIYUE Development Co.,ltd.: : CHENG,HONGXIA, : metalwork and raw material , coal , petroleum products , material testing equipment and products, : , 214012, Jiangsu, Wuxi, No. 397, GUANGQIN Road, .: (510) 2418590.
  • : 30.10.1985 .., : . , : ., .80
  • : : , - .., : , .: 937-99-92, : / , : www.ok.ru+ , : , id : 73288523, : ,
  • : 03.06.1987 .., : , .
  • : 22.6.1991 .., - .., : www.ok.ru+ , id : 27935346,
  • : : ... . 10, : MITSUBISHI CARIZMA 1995 ., 1597 ., VIN-XMCLNDA1ATF005196.
  • : : www.ok.ru+ , id : 3073221,
  • : 02.03.1983 .., : ,
  • : 14.11.1936 .., : , , , , , 37
  • : .: 89854572503 - . ( , iPhone 4 16 GB, , : iPhone, : 10000 .), :
  • Ionoigr Fwefn: : www.ok.ru+Ionoigr Fwefn, id : 73168575,
  • : 2103, (), , , , 14125, 1974 .., : , :
  • Ss Ss: : sssssssssssssssssss, : ssssssssssssssssss, : ssssssssssssssssss, : ssssssssssssssssssssssssssssssssssss, : www.ok.ru+Ss Ss, : sssssssssss, : sssssssssssssssssssssss, id : 73532365, : ssssssssssssss,
  • : 29.3 .., - .., : www.vk.com/id221176664.
  • : . , - .1 .1
  • : 24.04.1953 ..
  • : : www.vk.com/id220282781.
  • " " - " ": ,
  • : 29.01.1927 .., : , . .21 .2
  • : : www.ok.ru+ , id : 73490355,
  • : 05.08.1934 .., , . . 1, . (495) 1168191.
  • ' : : 3658200519, 27.02.2000 .., - .., : , ʲֲ
  • : 29.10.2033 - .., : , 2106, , 75356, 1997 .., : .37
  • : : www.vk.com/id220334649.
  • : 02.08.1950 .., , . . 16, . (495) 5218458.
  • : 08.01.1995 .., : , 453673
  • ˲: : 1720018616, 03.02.1947 .., - .., : ,
  • : 13.05.1936 .., : , . .119
  • : 17.08.1987 .., : , 453400
  • : 3.6.1978 .., .- - .., : www.vk.com/id146482801.
  • : : www.ok.ru+ , id : 73749393,
  • : : www.ok.ru+ , id : 73706643, : ,
  • : : ytr, : io, : uyu, .: 0554567890, : tytu, : www.ok.ru+ , : uyu, : kuythu, id : 73385059, : hjhjkhhgfgh,
  • : .: 8 (3832) 235049, : , , 2/1
  • "" ( ""): .: 07.09.2004 ., : 7018022689, : 1047000186056, : 701701001, : , : 634050, , , , 11.
  • : : www.ok.ru+ , id : 73586595,
  • : : <,=>,, : www.ok.ru+ , id : 3171198,
  • ò : 01.01.1969 .., : , - 5620855100, , 21., : , 2103, 23508, 1978 .., : 21030862857.
  • : 24.02.1961 .., : , , , , , 1, : 469, , , 97563 *, 615678, 615678, , 1985 ..
  • : 10.09.1955 .., : ., ..
  • : : ., .- - 38, : 350, 7681, 1972 .., : 384410.
  • : 24.8.1997 .., - - .., .: iphone 5, : Anastasia Alekseeva, : www.vk.com/id220077863.
  • 22.06.1990 ..: : ., . . .4
  • : 19.01.2009 .., : , , 45 2
  • s: 19.8 .., : , - .., : , : , : www.ok.ru+ s, : , id : 73552341, : . , , , , !,
  • : .: +7 (496) 566-96-01, +7 (495) 739-98-79, : ., -, ., . , 2, @-www: wurst.delikates@mail.ru, delikates90.ru, : , , , , ,
  • : 26.09.1948 .., : 443, , ., : /5301, , , 15263 *, Z53010W0010291, 001091, 001091, 027767, 1998 ..
  • в : : 3153116475, 30.04.1986 .., в - .., : , в
  • : 03.11.1996 .., : , - , - , 41.
  • : .: 8 9510034370, : , , , 11
  • Nietkaliev Nurxat: : www.vk.com/id220328031.
  • BANCO ESPAOL DE CREDITO S.A.: : 28807, Alcala Henares, .: +34 918.837.443
  • : : www.ok.ru+ , id : 73650850,
  • Ҹ: 2.10 .., : ?[Ҹ]?, : www.ok.ru+ Ҹ, id : 73859944,
  • : 20.03.2002 .., : , , , , 9
  • : - .., : www.ok.ru+ , id : 73501473,
  • : : , . . 8 . 3 ,
  • : : www.ok.ru+ , id : 27952107,
  • : 06.07.1983 .., : , , , 77.
  • : 22.03.1988 .., . , . .2 .2
  • : 19.06.1958 .., : , . .22/25
  • : : www.vk.com/id220115526.
  • : 3.10.1986 .., : www.ok.ru+ , id : 3166350,
  • : 29.10.1986 .., : , .
  • : 14.04.1945 .., : ., . -, 100
  • : 2.2.1994 .., : www.vk.com/id220684448.
  • : : () - 28.11.1996, , , (), .: 801653-29390, : , 225710 .,. . 4 ;
  • : TOYOTA CORONA, (), , , , 8682, 1992 .., : , :
  • Cvcm Xcvcm: : www.ok.ru+Cvcm Xcvcm, id : 73382531,
  • : 14.09.1964 .., : , . .5 .1
  • : 23.7 .., - .., : &,lt,&,lt,&,lt,&,gt,&,gt,&,gt,, : www.vk.com/id219976760.
  • Petrenko Sveta: : www.ok.ru+Petrenko Sveta, id : 73841330,
  • ʲ : : 1815319392, 13.09.1949 .., - .., : ,
  • : 06.10.2003 .., : , , , .
  • : 4.7.1961 .., : www.vk.com/id146858623.
  • : 1986 .., : , .,,4
  • : 24.08.1955 .., : , , , .21, .5
  • : 28.06.1961 .., : , 18
  • ò : : 3140812813, 28.12.1985 .., - .., : , вֲ
  • : 01.10.1935 .., : , . .18 .4
  • Ͳ ² : : 3146913159, 27.02.1986 .., - .., : , Ͳ
  • : 01.01.1944 .., : , 428, , ., 1
  • : 6.5 .., : www.ok.ru+ , id : 73495278,
  • : 31.08.1961 .., : 21113, 92702, -, 2112, 2001 .., : XTA21113010056040, 0056040, 0300745, .: 69507, : , , , 13.
  • : 13.02.1963 .., :
  • : 23.02.1933 .., : ,
  • "- "): .: 02.06.2008 ., : 2317001649, : 1072317001162, : 231701001, : 03426000000, : .2 .21.1 08.08.2001 129-, : 354340, , , , 8.
  • : 13.1 .., : www.ok.ru+ , id : 73294855,
  • : - .., : www.vk.com/id220194834.
  • : 06.03.1971 .., : , , , 7.
  • : 13.07.1953 .., :
  • : 25.4.1998 .., : www.ok.ru+ , : kozinasofua, id : 73384534,
  • : . , ., ., . 114 , .4.
  • : .: 8 (8312) 477624, : . , , 3
  • : : www.vk.com/id220391460.
  • : 22.12.2004 .., : , , .( -).
  • : 04.02.1986 .., : , .
  • : 05.03.1932 .., , . . 8 . . 8, . (495) 4043801.
  • : 4.10.1990 .., - .., .: 0996551525, : www.ok.ru+ , id : 73566567, : .,
  • : 22.4.1981 .., : www.vk.com/id220376088.
  • : 21.06.1984 .., : .
  • Tursunbekova Venera: 13.8.1974 .., : www.vk.com/id220825346.
  • : 12.6.1991 .., : www.vk.com/id220380230.
  • ..: : , . . 8 . 2 ,
  • : 03.04.1983 .., : 443110, , , , , 44, : , , -, 159163, 9L21230070157469, 0157469, 0168807, 2007 ..
  • : .: 9217345939, 88152 2, 509374, : , , 10; : , , 43
  • Ͳ : : 2405717218, 12.11.1965 .., - .., : ,
  • : 01.01.1939 .., . , . .78 .1
  • : 31.01.1959 .., : /
  • : 08.11.1960 .., , . . 73, . (495) 1701648.
  • Rodionov Artyom: : www.ok.ru+Rodionov Artyom, id : 3194584,
  • : 10.12.1927 .., , . 9, . (495) 9056812.
  • : 08.07.1976 .., H - .., : (.: 24.10.2001 H H . H) 7, .
  • : : www.ok.ru+ , id : 28040658,
  • : 25.10.1961 .., : , , 85, : ..., .: 8 (3812) 90, : 8131, 740755, 93_ ..
  • : 31031982 .., : ., .42, : ALLROAD, 649299, 2003 .., : WA1YD64B43N096156.
  • Mamedov Samir: 23.5.1965 .., Baku - .., : samir.mammadov.96, : www.vk.com/id220058424.
  • : 24.10.1938 .., : 21251, 94402, , 1991 .., : 2125100296702, 0296702, 6971573, .: 67215, : , , , 28.
  • : : www.vk.com/id220333344.
  • : : , : farwest206@mail.ru
  • : , . . 8 ,
  • : : www.vk.com/id220646126.
  • : 02.05.1973 .., : , , .
  • Grasys Vytautas: 6.11.1990 .., : www.vk.com/id220941236.
  • : : 3169813152, 14.10.1986 .., - .., : ,
  • : : www.vk.com/id220225568.
  • : 20.06.1918 .., : , , , 9
  • : .: 8 (921) 6513095, 4635960, 4635960
  • : 12.03.1945 .., : , . . 5, .: (495) 3852970
  • : 28.06.1982 .., : , 9- .66, : 05.06.2004
  • : 01.09.1950 .., : . 1
  • : 7.11.1996 .., : , : , - .., : , : , : www.ok.ru+ , : , : , id : 73700628, : , ,
  • : : - --> , : .
  • : .: 8 9056900483, : . . . 1
  • : : , . 11/1
  • : : www.ok.ru+ , id : 3256220,
  • : 1990 .., . - ..
  • : : , . .10 .1
  • Kaziev Nariman: : www.ok.ru+Kaziev Nariman, id : 73356370,
  • : 1994 .., : , .
  • : 1940 .., : , , , 22.
  • : 02.09.1940 .., : , . .15
  • : : www.ok.ru+ , id : 27942022,
  • : .: 89257327034 - . . 100/200 . . . ( , , , : , : 3000 .), :
  • : 03.07.1956 .,
  • : 12.07.1951 .., : ., , , .5
  • : .: -, +380449792083, : , , . 128/1
  • : .: 8 905 275 59 5*, : www.ok.ru+ , : , id : 73381740,
  • 04.04.1947 ..: : ., . .13
  • : : , -, .7, .2,
  • : 06.08.1982 .., : , : "" 5263059356, : , .
  • Meloyan Arshak: .: 098732200, : www.ok.ru+Meloyan Arshak, id : 73384633, : odnoklassniki.
  • : 23.08.2000 .., : , , ().
  • : 04.12.1989 .., : KIA RIO, , 712152, Z94CB41AADR102540, 2012 .., : , . . 36
  • : : www.ok.ru+ , id : 73475803,
  • : 05.12.1923 - .., : , 2101, , 69462, 1978 .., : .89
  • ʲ : : 1658114495, 25.05.1945 .., - .., : ,
  • : : . 214/1, .: 8 (383) 2624274.
  • : : www.ok.ru+ , id : 3087039,
  • Petiet A H: .: 162455744, : , , 4904MT, Oosterhout nb, Wagenaarstraat, 27.
  • : 2101, (), , , , 250424, 1984 .., : , :
  • : 26.05.1961 .., : , . . 3 . 2, .: (495) 4729432
  • : 01.12.1918 .., : , . .2/37 .1
  • : 10.3.1979 .., : www.ok.ru+ , id : 3145489,
  • Inoyatov Akbarjon: : www.vk.com/id221170507.
  • : : 3133213515, 13.10.1985 .., .ȯ - .., : , .ȯ
  • : - .., : www.vk.com/id220180339.
  • : 19.11.1964 .., : , , , 3 : " ".
  • Stm | pro^stir it up=) : : www.ok.ru+Stm | pro^stir it up=) , id : 73697291,
  • : : www.vk.com/id220617642.
  • : 20.10.1985 .., - - .., : www.vk.com/id220202024.
  • : 110757 .., : ., 1 .17 .0, : 1102, 9969, 1989 ..,
  • : 11.09.1993 .., : , , , 77
  • : .: 8 9147125254, : , ,. , 21
  • : 9.7.1994 .., : www.vk.com/id220967767.
  • : : miss.oksana-05@mail.ru
  • : : , . . 841 ., . (495) 5317598.
  • : 10.11.1958 .., : , - , , 32.
  • : : www.vk.com/id220108413.
  • : 26.04.1990 .., : , --, -, -, 15/4.
  • Szwech Natalia: : www.vk.com/id220437484.
  • : 17.3.1987 .., .: , : www.ok.ru+ , id : 73312751, : -, $$.
  • : .: 8 9242306858, : , , 1
  • : 07.04.1989 .., : , ., . , 48
  • : ..: 8 9046615796, : , 420000 45
  • : : www.vk.com/id220801118.
  • : NISSAN RNESSA, (), , , , 257589, 1998 .., : , :
  • : 01.01.1976 .., , . . 8 . 3, . (495) 3780528.
  • : CASA DE CREATIE ELVIRA MATEI S.R.L.: : 2001 ., : Aleea Vlasiei nr.6, Code Postal:061746, Bucuresti-6, Aleea Vlasiei nr.6, Code Postal:061746, Bucuresti-6, : 40722792845, : Atelier de pictur, pe porcelan, ceramic, lemn, pnz, n regim de unicat _i serie scurt., , , , , , , , , .
  • Onoodle Chatterbox: : www.ok.ru+Onoodle Chatterbox, id : 73875120,
  • : .: +79141736717, +74212401183, : 680000, , , , 3
  • : 09.12.1957 .., : , , .
  • : : www.vk.com/id220157734.
  • Chavoshi Mohsen: : www.vk.com/id221000620.
  • : : www.ok.ru+ , id : 3152212,
  • : 21.10.1970 .., .., : 1216010765,
  • : : , - . .65 .1
  • : 5.9.1987 .., : *??@*, : www.ok.ru+ , id : 3243636,
  • : TOYOTA LITE ACE, (), , 14, 14, 253418, 1997 .., : , :
  • : 02.01.1934 .., : . 20
  • : 21.5.2000 .., - .., : www.vk.com/id220186845.
  • : 01.01.1928 .., : ., ., , 9
  • : 26.06.1955 .., .: (495) 9797460
  • : 1955 .., : ., , ., . , 75
  • : 30.5 .., : www.ok.ru+ , id : 3266903,
  • : 24.04.1937 .., , . . 91 . 4, . (495) 1321918.
  • : 01.02.1967 .., : _!: , ., -, .
  • ˲: : 3167113454, 17.09.1986 .., Ͳ - .., : , Ͳ
  • : 27.1.1994 .., - .., .: 89081234772, : www.vk.com/id146823697.
  • : .: 80565152269, +380982130414, : , . .
  • : 24.6 .., .: *********, : www.ok.ru+ , id : 73317396,
  • : .: 8 (812) 2792406, .: 7536020 (Tele2), : , -, 243
  • : 26.06.1952 .., : , , 24, : , .: 8 (3812) 421873 , 421873 , 105, : SRL, 680, 91_ ..
  • ..: , . . 8 ,
  • Ceferli Kamran: 9.6 .., : www.vk.com/id220729680.
  • Mandal Anup: 1.3.1989 .., DELHI - .., .: 07206176902, : www.vk.com/id146640266.
  • : .: 8 9025574343, : , -, 66
  • : 30.10.1930 .., : , . . 27 . 3, .: (495) 4730069
  • : 07.10.1978 .., , . . 23, . (495) 4051190.
  • : : 2729220935, 21.09.1974 .., - .., : ,
  • 04.02.1987 ..: : ., . . .2
  • : : www.ok.ru+ , id : 73510104,
  • : 22.03.1994 .., : , , , 7
  • : .: 89059165511 (), : 652840 . . 20
  • - : : 629300, . , . 26 15/, .: /3494/ 99-61-61, /3494/ 99-61-55, /3494/ 99-61-56.
  • : 31.8.2000 .., : www.ok.ru+ , id : 73246555, : http://vk.com/http:/dankuzmin28.
  • : : www.vk.com/id220025870.
  • : : www.vk.com/id220550470.
  • A: : ., , - , 1986 .., : 0049, 9319830, 2413570, :
  • : .: 8 (921) 6561768, 106-82-25, 106-82-25
  • ò : : 3222410772, 23.03.1988 .., - .., : ,
  • "" ( ""): .: 10.09.2011 ., : 6674134724, : 1046605191896, : 667401001, : 65401390000, : , : 620000, , , , 25.
  • Ton Pl: : www.vk.com/id220711269.
  • : 15.09.1928 .., : ..:;
  • Wendox Santa: : www.vk.com/id146844715.
  • 135: : , - 35.
  • : 11.09.1982 .., : , .
  • : 19.03.1934 .., : , . .3 .3
  • : 21.11.1975 .., : , - 5620888001, ., ., : , 412, 68752, 1985 .., : 0682619.
  • Milkov Denis: : www.vk.com/id220368424.
  • : 21.2.1994 .., - .., : . . , .. . , . . . , . . . , , . , . , . Disciples III: , . - , , , , : skype_anubis32, : www.ok.ru+ , : , Avril Lavinge, Paramore, Skillet, Escape the fate, Black Veil Brides, Sum 41, Thousand Foot Krutch, Three Day Grace, Silverstein, 30 Second to Mars, Breaking Benjamin, Billy Talent, Good Charlotte, Cult to follow, Dead by Sunrise, 4pe , A Day to Remember, Alesana, Eyes set to kill, Picture me broken, Dead by April, Bullet for my Valentine, Falling in reverse, Get scared, Rise against, 1.5 , , Ska-P, , -, The Pretty Reckless, id : 28059695, : http://www.lastfm.ru/user/rexxas.
  • : 13.10.1961 .., : , -
  • Voloshin Dina: : www.vk.com/id220796446.
  • : 14.09.1953 .., : ., , , 119
  • : : www.vk.com/id146904722.
  • Derete Jackson: : www.vk.com/id220510004.
  • : 12.04.1989 .., : , --, -, ., 24. : , : , 1, : , .: 52-60-64.
  • : : , . 48
  • : 27.07.1938 .., : , . 11
  • Car' : .: +7 (812) 617-00-70, : -, ., 72, .1, : , , , , , , , ,
  • : 24.09.1924 .., H . H H H H - .., : (.: 30.07.2002 "H" H . H) 7, .
  • : 14.03.1962 .., : , . .6
  • в : : 2052722018, 14.03.1956 .., - .., : ,
  • : 22.8.1978 .., : www.ok.ru+ , id : 3245953,
  • : 11.02.1978 .., : , . . 8 . 2, .: (495) 4974493
  • : 7.12.1997 .., : www.vk.com/id220485516.
  • : 22.12.2000 .., : , . .23 .1
  • Ѳ IJ: : 2090823512, 30.03.1957 .., - .., : , ò'
  • : 25.12.1999 .., : , 28
  • : 18.4 .., - .., .: -, : -, : www.vk.com/id146482310.
  • Frowijn-vd Berg Th M: .: 302204738, : , , 3731BG, De Bilt, Francois Mauriacweg, 243.
  • : 27.06.1995 .., : . , : , .
  • : 21.10.1952 .., : , . .29
  • : 18.06.1986 .., : , . .56 .1
  • : 06.08.1946 .., : , - , 16.
  • : : www.ok.ru+ , id : 3134879,
  • : 25.08.1984 .., : ().
  • : 09.11.1973 .., : ., .- , .: 8 (812) 1575309, : MB316, 26678, 1998 .., : WBACG11060KD99367, 164E205258896.
  • Lev Nana: 29.2.1984 .., : www.ok.ru+Lev Nana, id : 3227678,
  • : 19.06.1964 .., : 446720, , , , -, , 6 2, : 21074, , -, 40463 *, 21074042003920, 2003920, 7667503, 2004 ..
  • : .: 8 9601306203, : 396000 . . 9
  • : 04.11.1941 .., : , , , 24
  • : 09.09.1950 ..
  • : 14.10.1997 .., - .., .: 87021259697, : www.vk.com/id220799730.
  • ? : : www.ok.ru+? , id : 73675184,
  • : 5.9 .., - .., : www.vk.com/id220327537.
  • : 27.8.1998 .., : www.ok.ru+ , id : 73594912,
  • : : 3064620977, 27.11.1983 .., - .., : ,
  • Ͳ Ѳ: : 3150715532, 06.04.1986 .., - .., : ,
  • : 02.11.1950 .., : , , , , , 17, : 2121, , , 87163 *, 212100D0278036, D0278036, 6485519, 1983 ..
  • : .: 8 9084446333, : , , , 6
  • : 01.01.1965 .., , . . 1/23 . 2, . (495) 3793208.
  • Sirisena A L: : -, KBK, 178/A Kehelwala Kiribathkumbura
  • : : www.ok.ru+ , id : 73704852,
  • ³: 6.5.1999 .., - .., : www.vk.com/id221058413.
  • : 28.11.1996 .., :
  • : 11.08.2006 .., : - , ., ., 23
  • : 6.1 .., : www.vk.com/id146760857.
  • : 30.5.1992 .., : , - ., - .., : . , : , - 2 , , , , , , ., : elena1992_2012, : www.ok.ru+ , : Comedy Club , Stend Up , : elena_petrova71, : , , ., id : 27709791, : http://http://www.odnoklassniki.ru/profile515914284430.
  • : : www.vk.com/id220747533.
  • : 24.4 .., - .., : www.ok.ru+ , id : 27732046,
  • : TOYOTA TOWN ACE, (), , , , 32425, 1993 .., : , :
  • : : www.vk.com/id220893032.
  • : 1.1.1990 .., : www.ok.ru+ , id : 73746995,
  • HAIMENSHI LIUKUANG YUZHONG Leather Shoes factory: : NI,YUZHONG, : leather shoes , processing , marketing, : , 226132, Jiangsu, Nantong, SIZU, ANFENG Village, LIUKUANG Town, .: (513) 2663815.
  • : 10.05.1952 .., : , . .47 .1
  • : 04.02.1998 .., . , . 8
  • : 02.01.1947 .. : .
  • : : www.vk.com/id146791500.
  • : 12.07.1938 .., : , . .29
  • : 22.7.1958 .., : www.vk.com/id220068836.
  • : 30.04.1985 .., : ., --, , 85.
  • : 2.12.1960 .., : www.ok.ru+ , id : 3067475,
  • : 18.05.1999 .., : , , , 67.
  • : 28.6.1989 .., : www.ok.ru+ , id : 3187245,
  • Nsdntzsdns Nstntns: : www.ok.ru+Nsdntzsdns Nstntns, id : 73368879,
  • Melnikova Natalia: .: +7-988-987-88-37, : www.vk.com/id220189060.
  • : 27.05.1959 .., : , , -.
  • : 25.01.1974 .., : , , /, , , 14
  • : 23.02.1983 .., : .
  • : : www.ok.ru+ , id : 73494699,
  • : 13.9.1982 .., : www.ok.ru+ , id : 3127646,
  • You_ _love: : =**, : www.ok.ru+You_ _love, id : 73541917,
  • : 15.3.1988 .., .: 8914-------------, : www.ok.ru+ , id : 73402895,
  • : 08.09.1938 .., : , , ., -, ., ., 35, : 21074, -, 443163, 21074072532939, 2532939, 8826303, 2007 ..
  • zzz.Traci: : , : yul.ostrovskaya@yandex.ru
  • : Vegas Foodstuff Trading: : Head Office, : 1987 ., : Dubai PO Box 21751, PO Box 21751 Dubai Behind Gargash Enterprises, Sharjah Industrial Area 6 Dubai United Arab Emirates, : Suresh Mehta - Managing Director, : 97165584504, vegasff@emirates.net.ae, : Distributors : 6 : 4000000 AED : Emirates Bank Int'l Ltd.
  • : 21.01.1972 .., : , .142
  • : 5.7.1992 .., - - .., : www.vk.com/id220350820.
  • : 22.5.1988 .., - .., : www.ok.ru+ , id : 73494538,
  • : 19.1.1992 .., : www.ok.ru+ , id : 27707737,
  • : 24.08.1959 .., :
  • : 5.6.1983 .., - .., : www.vk.com/id220353468.
  • .. ., - 15 (2000.02.01 ): .: 8 (473) 27548821
  • : : ., . -, 4
  • -: 16.09.1980 .., : - , ., ., 4
  • : 12.08.1963 .., : , . .12 .2
  • : 21.09.1933 .., : , 15- . .24 .1
  • : 04.09.1988 .., : - 17, . : "-".
  • : .: 8-921-5406112 (), 246598, : ., , 6
  • : 2.3.1976 .., : www.ok.ru+ , id : 3109942,
  • : 05.05.1966 .., : ., , , 15.
  • : 23.8.1997 .., - .., : www.vk.com/id220234484.
  • : 1963 .., : ., , , , 89
  • : : www.vk.com/id220742636.
  • : .: 89637824588 - . , . . 1, 2, 3 . (, 1- , , 1- ), : , .
  • : .: 89056576195 (), : ., 397900 . . 83
  • : 06.03.1955 .., : ,2-36
  • 2844597: .: 8 9502844597, : , , 13
  • : : www.vk.com/id220306639.
  • : 12.11 .., : www.ok.ru+ , id : 3089039,
  • ز ò : 11.11.1911 .., : , - 5623482601, ., ., : CIZETA, 350, 8457, 1988 .., : 0, 4726068811.
  • : - .., .: )), : www.vk.com/id146676429.
  • Gut Tina: 9.3.1992 .., : www.vk.com/id221202678.
  • : 01.01.1982 .., : ., , , .25
  • Hgjghj Ghjghj: : www.ok.ru+Hgjghj Ghjghj, id : 73068336,
  • GANYU County Higher School Recruit students Committee Office: : YAN,XIUBAO, : recruit students examine matriculate, : , 222100, Jiangsu, Lianyungang, No. 16, WENHUA Road, QINGKOU Town, .: (518) 6212986.
  • : : www.vk.com/id146713232.
  • : 28.12.1998 .., : /Delmar/, : www.ok.ru+ , id : 73410024,
  • : .: 8 (342) 235595, : . , , 49
  • : 17.04.1984 .., . , . .455
  • : : www.ok.ru+ , id : 73665940,
  • : 12.03.1979 .., : - , ., ., 16
  • : , .21 . : : , : 21.12.1994, :
  • : 25.01.1946 .., : 2102, 39102, , 1974 .., : 0128716, 0956014, : , .
  • : : www.vk.com/id221004678.
  • : 30.04.1995 .., . , . .37
  • : 1964 .., : ., , c
  • : 10.10.1973 - .., : , , , , , 11, : MAZDA 626, , B410ZOM, JMZGV12D201221086, 1991 ..
  • : 06.09.77 .., : , , . , .-, 15
  • : 30.03.1936 .., : ., . -, 5
  • : 10.03.1949 .., : , . .22 .2
  • : 3.11 .., .-i - .., .: +77058611166, : www.vk.com/id220161159.
  • : : www.ok.ru+ , id : 27788001,
  • : : , . . 18, . (495) 2896481.
  • : ..: 8 9172599220, : , . , .25
  • : 18.07.1944 .., : , . 5, .: (495) 9451955
  • : 16.8.1988 .., : www.ok.ru+ , id : 3141917,
  • : 09.08.1949 .., H H - .., : , , 18.
  • : : www.vk.com/id220395007.
  • : 6.6.1973 .., - .., .: 7987475****, : www.vk.com/id220865504.
  • : 28.6.2000 .., : www.vk.com/id221076095.
  • Ѳ ˲ Բ: 26.02.1959 .., : , - 5640100000, ., 8, : , 2125, 8486, 1987 .., : XTK212510H0101877.
  • : 04.02.60 .., : , , -., ., ., 6. : " ", 457005, .
  • : 27.6 .., - - .., : www.vk.com/id220810756.
  • Voortman J H: .: 529456771, : , , 7731CJ, Ommen, Groen van Prinstererstr, 5.
  • : 3.1.1964 .., - .., : www.vk.com/id221022440.
  • -IJ ˲: : 2469419134, 11.08.1967 .., - .., : , .ȯ
  • Dgdgg Dgdg: : www.ok.ru+Dgdgg Dgdg, id : 73444841,
  • : 26.09.1931 .., , . . 12, . (495) 9470745.
  • : 17.7.1980 .., : www.vk.com/id220855491.
  • : : , . 693
  • : : www.ok.ru+ , id : 73766498,
  • : 17.07.1981 .., . , . .26
  • : 13.1.1989 .., - .., : www.vk.com/id221060440.
  • ( .): 11.05.1952 .., : ." , : -
  • : : www.vk.com/id220104311.
  • : : , , , (), : , : , 231510 . . 162;
  • Sapega Olga: : www.ok.ru+Sapega Olga, id : 73598318,
  • : 19.4 .., . - - .., : www.ok.ru+ , id : 73437836,
  • : .: 8921745..., : www.vk.com/id220312832.
  • : : www.ok.ru+ , id : 28058916,
  • : . , ., ., .125
  • : 03.04.1987 .., : , . .1107
  • : 29.06.1981 .., - .., : 424000 . - - . 31, : 121507580807,
  • : 27.09.1979 .., : ,
  • : 24021966 .., : ., 30 .30, : 2104, 18664, 1990 .., : XTA210400L0249152.
  • LIANSHUI County Village & town Financing Coach Station: : LI,CHANGCHUN, : village & town financing administrate coach, : , 223400, Jiangsu, Huaiyin, West Side, JIANGHUAI SHANGCHANG, .: (517) 2321141.
  • : : www.ok.ru+ , id : 73306607,
  • : .: 80626434481, : , 84300, ., . 19 'I, .24
  • Gewgtr Lhljh,pl: : www.ok.ru+Gewgtr Lhljh,pl, id : 73160262,
  • : TOYOTA CARINA ED, (), , , , 07025, 1986 .., : , :
  • : 11.9 .., - .., .: - , : , : www.vk.com/id146737038.
  • : .: 8 9242631720, : , ; , 82
  • : 13.01.1970 .., : , -, , 1. : / "".-
  • Trinidad Lerimae: : www.vk.com/id220311331.
  • : . .: 8 9609091143, : 650000 . . 37
  • : 01.01.67 .., : , , , 32.
  • : 06.10.1985 .., : ., , . , , .9
  • : : , - .., : , : , : www.ok.ru+ , : , : , id : 73698863, : ,
  • : 25.07.1980 .., . , . .41 .2
  • : 12.11 .., : www.ok.ru+ , id : 28060318,
  • : 1.8.1998 .., : www.vk.com/id220126671.
  • : 18.11.1985 .., - .., : www.vk.com/id221121653.
  • "- " - "- ": , , : 5020037030
  • : - .., .: , : net, : www.vk.com/id146898544.
  • : : , . . 3, . (495) 1946766.
  • : 04.07.1969 .., : * **, : ., . .7
  • : 23.02.1962 .., : , - , , 26.
  • : 26.05.1970 .., : , , 70
  • : 24.02.31 .., : , , . , . "", 641
  • : : www.ok.ru+ , id : 3233492,
  • Makarova Lera: 1.11 .., : www.ok.ru+Makarova Lera, id : 73384850,
  • : 17.04.1938 .., : ., . -, 15
  • : : ., . -, 20
  • : 01.09.1953 .., : . 35. : " ".
  • : 09.08.1930 .., : , - , - , 34.
  • : : www.ok.ru+ , id : 73317636,
  • : 25.4 .., : www.ok.ru+ , id : 27957822,
  • : 08.03.1940 .., : ,
  • : 16.6.1993 .., : L=L-L--- L+=L L,- -++-T- +--L!!!, : HALF-LIFE SUBSTANCE, POSTAL AWP, - .., : , , , .: 89135243657, : , , , : www.ok.ru+ , : SOUTH PARK, , : DISTEMPER, DER STEINKOPF, RAMMSTEIN, OOMPH!, , , , L, , , SYSTEM OF A DOWN, id : 73176663, : , , punk rock, : .
  • : : www.ok.ru+ , id : 73363849,
  • : 30.05.1954 .., : . -, -, ., 28, .: (812) 3501909.
  • : 11.11 .., : www.ok.ru+ , id : 28034774, : http:// svobodnii-volk.ucoz.ru/.
  • : : . 52, .: 8 (383) 3539110.
  • ***** Inna: : www.ok.ru+***** Inna, id : 73524282, : ****************,
  • : 17.10.1972 .., , . . 57 . 3, . (495) 3580023.
  • : 07.08.1954 .., : , - 5625450100, I, 17, : , 2121, 8135, 1981 .., : BA2121 0172300, 0172300.
  • : 31.7.1990 .., : www.ok.ru+ , id : 3285538,
  • Qweqwe Qweqwe: : www.ok.ru+Qweqwe Qweqwe, id : 73346541,
  • YIWU CITY FENGTUOLING IMPORT & EXPORT CO.,LTD - , : ZHEJIANG YIWU CITY YINGFENG YUAN, DONGZHOU GARDEN,UNIT 1ST,BUILDING 5, : " ", : 660061, , , . 78 , .12, : - 2-301-722, : (, , , ). - 5900 . -
  • : 25.06.1966 .., : , . . 26 . 2, .: (495) 1435519
  • : 06.06.1977 .., : ., . -, 5
  • : 01.05.1966 .., : ., . -, 19
  • : 8.8.1985 .., : , : , - - .., : , : , : www.ok.ru+ , : , : rnb, pop., id : 3222765, : , !!,
  • Whyte Scott: : www.ok.ru+Whyte Scott, id : 27849131,
  • : 3.12.1998 .., : www.vk.com/id220243661.
  • : 12.03.1985 .., : , .
  • : 13111959 .., : ., .44, : MAXIMA2.0, 640748, 1998 .., : JN1CAUA32U0056266.
  • 24.09.1986 ..: : ., . .48
  • : 27.02.1902 ..
  • : 14.06.1959 .., : , . . 49 . 4, .: (495) 3280096
  • : : www.ok.ru+ , id : 3072569,
  • : 20.05.1964 .., : , .
  • , : , . , .
  • : : 2838218958, 15.09.1977 .., - .., : ,
  • : : www.vk.com/id220320108.
  • : 14.08.1972 .., : , -
  • : 12.6.1992 .., : www.vk.com/id220981709.
  • : : www.ok.ru+ , id : 73232386,
  • : : www.vk.com/id221200484.
  • : : www.ok.ru+ , id : 73585155,
  • в : : 2494520819, 18.04.1968 .., - .., : ,
  • : 22.8.1987 .., : www.vk.com/id146682468.
  • : : www.ok.ru+ , id : 73290286,
  • : 08.05.1965 .., : , .
  • : 11.9 .., .: ------------------------, : www.ok.ru+ , id : 73672043, : --------------------7.
  • : : cbc, : cbcb, .: vx, : nnccn, : www.ok.ru+ , : ncncn, : cncn/., .m, nmbnvbcxzdsadghbkjl,, id : 73243610, : vcnccnczxxcvn./',lwefvujhn, : vx.
  • : 13.04.1982 .., H - .., : , , 7.
  • : 02.01.1957 .., . , . .8
  • : : www.ok.ru+ , id : 73806434,
  • Ѳ ò: : 1756326658, 01.02.1948 .., - .., : ,
  • : 12.06.2005 .., : ., .- . . 15.
  • : : www.vk.com/id221144430.
  • : 16.07.1912 .., , . . 17, . (495) 3914692.
  • : : www.vk.com/id221070202.
  • Smirnova Masha: 4.2 .., : www.vk.com/id146503382.
  • : 10.11.1958 .., : 311000, 49102, -, 1997 .., : H311000V0064185, 630535, 0064185, 3401550, : , , , 32.
  • : 10.12.1958 .
  • : .: 8 9147320229, : , , 8
  • Vfrc Vfrc: : , : , - .., : , .: 3245, : , : www.ok.ru+Vfrc Vfrc, : , : , id : 73381588, : , : 2345.
  • : 29.12 .., : www.ok.ru+ , id : 27723675,
  • Eeuwes H H M: .: 481423297, : , , 6691HL, Gendt, 't Hof, 17.
  • Mmmmm Zzzzzz: : www.vk.com/id220076836.
  • : : www.ok.ru+ , id : 27845194,
  • : 30.9.1987 .., - .., : www.vk.com/id146816693.
  • : 1934 .., : . , , , 134.
  • : : , . 32, . (495) 4241193.
  • : 29.03.1979 .., : , , , ., ., 192
  • : : www.ok.ru+ , id : 27914462, : http://sprashivai.ru/Orlova__Anya.
  • : .: 096***, : www.vk.com/id146937763.
  • : 03.06.1979 .., : ., .- - 60 - 46, : LI 14, 67278, 2003 .., : VF1BB130A29174004, K4JB711R000403.
  • Steel Red: .: ------, : pon4ik, : www.vk.com/id146743325.
  • : 28.06.2006 .., : - , .
  • : : ., , : 21065, 17364, 1996 .., : XTA210650T3622335.
  • : 01.10.1955 .., : , . . 16 . 2, .: (495) 3716555
  • : .: 9119102067, : , -, , .18, .1
  • : 19.06.1959 .., , . 2- . . 4, . (495) 9523359.
  • Sivananthan Sivanujan: 13.2.1999 .., torando - .., : www.vk.com/id220058025.
  • ò : : 3189312357, 27.04.1987 .., - .., : ,
  • : . .: 8 9065449976, : . . 25 .1
  • ????? ???-?????-?????: : www.vk.com/id220791795.
  • : 26.10.1977 .., : / .
  • ժ˲ ʲ: : 1648910130, 22.02.1945 .., - .., : , ʲ
  • : 13.10 .., : www.vk.com/id220016453.
  • : - " ". : 321-25-34. : 1000000 .
  • : 02.02.1961 .., : , : ., .6
  • : .: 8 9246444669, : , ;, 8
  • : 1.12.1984 .., - .., : www.vk.com/id221196136.
  • Empresa Estatal Socialista EES: .: 593465, : , La Marina, Heredia #3 Niquero
  • : 16.09.1957 .., . , . .65/47 .1
  • : 1.1 .., - .., : www.vk.com/id220504170.
  • Lassooij A J: .: 599620548, : , , 9502WZ, Stadskanaal, Englumborg, 4.
  • 05.09.1988 ..: : ., . 1 . .10
  • : 01.01.1900 .., : , - 5924786301, 0, : , 11, 3943, 1993 .., : 0, 836931.
  • : 29.05.1967 .., : , . , -, ., 12, .: (812) 4640573.
  • LIANYUNGANG City Wallmaterial Regenerate Office: : CHEN,SHUNXING, : put into effect engergy saving policy . promoting new wall material, : , 222000, Jiangsu, Lianyungang, No. 16, CHAOYANG ZHONG Road, .: (518) 5413045.
  • : 27.9.1999 .., - .., : www.vk.com/id221047562.
  • : : , -, 35-17; ( ), .: 0112-466209.
  • ..: , . . 38 ,
  • Garcia Julio: : www.vk.com/id220342078.
  • : 04.03.1953 .., . (495) 1285878.
  • : - .., : www.vk.com/id220366380.
  • : 22.08.1994 .., , . . 36, . (495) 3547253.
  • : : , . . 9 . 2 ,
  • : 23.6.1995 .., - .., .: 911751119, : ostaphervazyuk, : www.vk.com/id220753242.
  • : 7.2 .., .: -, : www.ok.ru+ , id : 73586875,
  • : : www.vk.com/id221047600.
  • ȯ Ѳ: : 3422502638, 14.09.1993 .., - .., : ,
  • : NISSAN LIBERTY, (), , 14, 14, 250714, 1999 .., : , :
  • : : , - .., : fritz_skype1, : www.ok.ru+ , id : 3189603, : http://purse.su.
  • Ҳ : : 2821021750, 27.03.1977 .., - .., : ,
  • : 19.03.1956 .., : , , 175.
  • : .: 8 3952323979 (8 3952 323979), : , , , 1
  • : 6.5 .., : , : www.ok.ru+ , id : 73284394, : .ru.
  • : 02.08.1928 .., : , 3- : 16.09.1951 .., : , . . 9 . 2, .: (495) 9030116
  • : 24.06.1964 .., , . . 1, . (495) 1429373.
  • : : 3290509477, 02.02.1990 .., ײ - .., : , ײ
  • : 24.12.1980 .., : , , 8, : , .: 8 (3812) 571356, 571356, : 2106, 710, 97_ ..
  • : 22.06.1955 ..
  • =* : : www.vk.com/id146554747.
  • : : 3270, 03002, , 1988 .., : Y, 1158979, 0040010, 13286, : , .
  • : 23.05.1951 .., : , , -, 32
  • : 7.10.1985 .., : www.ok.ru+ , id : 28052314,
  • : 09.04.2004 .., : , , , 6,
  • : 11.05.1981 .. : . : "-"
  • : .: 8 4236635325, : , ,,692903, 96
  • : 26.5.1983 .., : www.ok.ru+ , id : 3285329,
  • : 13.08.1986 .., : , . . 27, .: (495) 4756654
  • : 01.06.1986 .., : , , , 155
  • : 19.1 .., : www.ok.ru+ , id : 3114436,
  • : .: 9217091763, 81553-9, 81553-9, : . , , 8; : . ., , 8
  • : : www.vk.com/id220925234.
  • : 24.10.1940 .., : ., . -, 50
  • : 23.5.1998 .., : www.vk.com/id220673363.
  • : :
  • : 13.05.1981 .., : , , , 9
  • Davcyan Anulik: : www.vk.com/id221066137.
  • : : , . . 2, . (495) 4254853.
  • Louche : 3.4 .., : RL, : www.ok.ru+Louche , id : 3199025,
  • : 13.06.1970 .., : , - 5640100000, , 132, : MAZDA, 626, 05495, 1985 .., : JMZGC143201513244.
  • : 5.11.1995 .., : elizabethroosioks, : www.vk.com/id220739800.
  • : : , . . 9, . (495) 1821750.
  • : : --> , : Sky Express.
  • =) : 18.5.1995 .., : ))@)), : . !)), - .., : , , : , : www.ok.ru+=) , : 2, : !)), id : 73753131, : , , . !)),
  • : . .: 8 9617005449, : 650000 . . 3
  • : 31.1.1977 .., - .., : www.ok.ru+ , id : 27932412,
  • : - .., .: , : www.vk.com/id221193340.
  • : 1963.08.05 .., : ., -, , , 16, : 21061, , 44136, , 1994 ..
  • : 07.10.1946 .., : , . .25
  • : 3.7.1969 .., : www.ok.ru+ , id : 27885763,
  • : 28.5 .., - .., : www.vk.com/id146940728.
  • ..: , . . 19 ,
  • Asdfhgdxf Ashio: 5.1 .., rostoV - .., : www.vk.com/id146553079.
  • : 25.06.1956 .., : , . .9 .1
  • : 01.01.1990 .., : , , , 25
  • : 29.06.1927 .., . , - . .40
  • : : www.vk.com/id146649170.
  • : 29.12.1979 .., : , , .( -).
  • : : www.vk.com/id146928211.
  • : - "". : ., , , 161. : 37-17-63, 37-17-64, 37-17-63, 37-17-64
  • : : www.ok.ru+ , id : 73211515,
  • : : yulia.gudilina.98@mail.ru
  • "" ( ""): .: 04.09.2009 ., : 7703552216, : 1057747099728, : 770301001, : 45286575000, : , : 123557, , . , 29.
  • : .: 8 9241084844, : , ;, 42
  • : : www.ok.ru+ , id : 73140772,
  • ..: , . . 33 ,
  • : 15.04.1994 .., : , . .18 .3
  • : 11.11.1961 .., : , . .113 .1
  • : 11.12.1967 .., . , . .10 .3
  • : .: +79243858066, +73022343463, : 672000, , ,
  • : : www.vk.com/id220364235.
  • : 04.11.1931 ..
  • : 15.12.1928 .., : , , 67
  • ? ?: .: 87013415357, : www.vk.com/id220451591.
  • : : 2201424294, 09.04.1960 .., - .., : ,
  • : 24.08.1962 .., : ., ., ., .6
  • : 28.05.1946 .
  • Xzz Xzz: : www.ok.ru+Xzz Xzz, id : 73135654,
  • : - .., .: 8988*******, : www.vk.com/id220831869.
  • : : www.ok.ru+ , id : 73307157,
  • : : ., - 6, : , 02647, 1983 .., : 0120532.
  • : 22.12.1992 .., - - .., : pino4et92, : www.ok.ru+ , id : 27960720, : https://www.behance.net/Pinochetmx.
  • : .: 8 9027515808, : , , 10
  • : - .., : www.ok.ru+ , id : 73800533,
  • : 21.05.1960 .., : , . . 66 . 2, .: (495) 1161590
  • : 250859 .., : ., .40, : 2140, 98164, 1979 ..,
  • Hole Mr: : www.ok.ru+Hole Mr, id : 73434257,
  • : 21.8.1997 .., .: 87014048033, : www.vk.com/id220103736.
  • : .: 8 9089697219, : , , , 107
  • : : www.vk.com/id146509144.
  • : 4.7 .., : www.ok.ru+ , id : 73234091,
  • : 01.01.1930 .., : ., . -, 17
  • : 4.7.1990 .., .: 8-926-688-24-22, : www.ok.ru+ , id : 3187429, : http://vk.com/club59765734.
  • Tartus Sergei: 16.8.1965 .., : www.vk.com/id220363217.
  • .: : 55111, 42902, -, 7403,10, 1999 .., : IF551110000169, 2104259, 0000169, 108244, : , , , 10.
  • : 08.08.1924 .., : ., . -, 23
  • : : , - , , 14, : 21412, 4410, 1993 .., : 0414577, 0416337
  • : : www.vk.com/id221072796.
  • : 19.04.2000 .., : , , , , 5
  • : 02091972 .., : ., . .23, : 21140, 77064, 2004 .., : XTA21140043793514.
  • : 08.06.1953 .., : ., , , .34
  • : 31.05.1958 .., . , . .12 .2
  • Cl Lhiz: : www.vk.com/id220987543.
  • : 11.11.1974 .., , . . 27/25, . (495) 3991498.
  • : : , . 2, . (495) 4460581.
  • : : www.vk.com/id220659311.
  • : : , : , - .., : , : , : www.ok.ru+ , : -2, : , id : 3204736, : ,
  • : 4.7.1975 .., : www.ok.ru+ , id : 28000866,
  • ..: .: 8 (3842) 236842, : , , 9-, 10
  • : : , -, 14 2
  • : 09.08.1936 .., : , . . 6, .: (495) 4668036
  • : 10.11.1943 .., : , , , ., 6
  • Ssss Ssss: : gggggggggggggggggggggggggggggggggggggg, : ggggggggggggggggg, : gggggggggggggggggggg, : gggggggggggggggggggg, : www.ok.ru+Ssss Ssss, : ggggggggggggggggggggggggggg, : ggggggggggggggggggggggggggggggg, id : 73242420, : gggggggggggggggggggggggggggggggggggggggggg,
  • : 16.11.1966 .., : , .
  • : 5.6.1980 .., : www.vk.com/id146529291.
  • : .: 8 9089871626, : , , , 42
  • : : www.vk.com/id220674756.
  • : 16.11.1918 .., : , . . 10 . 6, .: (495) 9364540
  • : 03.02.1972 .., : --, 38 62
  • Sefse Efs: : www.ok.ru+Sefse Efs, id : 73287938,
  • : 18.4.1996 .., : www.ok.ru+ , id : 73377730,
  • : , . . 5 ,
  • : , . . 20 ,
  • ' : : 749901979, 13.07.1920 .., - .., : ,
  • : 18.9.1986 .., - .., .: , : , : www.vk.com/id220179391.
  • : : www.ok.ru+ , id : 73826196,
  • Mkvdari Mkvdari: : www.ok.ru+Mkvdari Mkvdari, id : 73714193,
  • : 19.06.1976 .., . , . .4 .2
  • : 18.04.1952 .., : 97060, , , -, , ., 48.
  • : : Pav1entiy, : www.ok.ru+ , id : 3237295,
  • : 07.11.1942 .., : - , ., ., 51
  • : 26.06.1982 .., : . . . 17
  • : 18.05.1976 .., : .,..
  • : 01.01.1939 .., : ., --, , 108.
  • : 12.07.1933 .., : ., ., , .79
  • : .: 0939334768, : www.ok.ru+ , id : 73098745, : .
  • : 07.10.1986 .., , . . 46 . 3, . (495) 4746759.
  • : : , . 18
  • () (): : www.vk.com/id146472639.
  • : 14.06.1958 - .., : , 21103, , 48056, 2000 .., : 1 .206
  • : 27.04.1979 .., : , , 16 : " " - " "..
  • : 4.11 .., : www.ok.ru+ , id : 73855397,
  • : : www.ok.ru+ , id : 73149885,
  • : 19.6 .., - .., : www.ok.ru+ , id : 27743285,
  • : 22.01.1949 .., : , : , .
  • : 01.05.1931 .., : , .93 .1
  • Semenov Pavel: : www.ok.ru+Semenov Pavel, id : 73190329,
  • : 01.01.1966 .., : ., --, , 233.
  • : - .., : www.vk.com/id220522818.
  • : : www.ok.ru+ , id : 73840625,
  • Szczuka Marcin: : www.vk.com/id220508492.
  • : .: 8 (921) 9539375, 2264306, 2264306, : -, 40\3
  • : : , . . 37 . . 37, . (495) 3743470.
  • : : ., 36 , .: 9211384420
  • : 23.06.1976 .., : , , .
  • : 09.03.1968 .., : , 3- . . 19, .: (495) 2883608
  • : : www.vk.com/id220224573.
  • : 30.03.1976 .., : , , . : " ", : ., ..-.
  • IJ: : 3108517070, 08.02.1985 .., .ȯ - .., : , .ȯ
  • ò ò: : 2682821570, 14.06.1973 .., ײ - .., : ,
  • : 06.11.1958 .., : , . .5 .2
  • : : www.ok.ru+ , id : 73316978,
  • : 1943 .., : , , 36-.
  • Roshka Ekaterina: : www.vk.com/id220131898.
  • : .: 8 9046202703, : , , , 58
  • : 1930 .., . - - ..
  • "": : . , .: 8 (4922) 253107.
  • : : www.ok.ru+ , id : 73840671,
  • : : www.vk.com/id221117644.
  • : 29.5.1994 .., : www.vk.com/id146861431.
  • Kluk Witold: 21.3.1993 .., Magnitogorsk - .., : www.vk.com/id220548032.
  • Drugg0008 Drugg0008: : www.ok.ru+Drugg0008 Drugg0008, id : 73094870,
  • : 07.07.1973 .., :
  • : 31.12.1969 .., , . . 7, . (495) 4034658.
  • : 04.09.1937 .., : , .
  • : 15.08.1957 .., : , . .62/1
  • Centeno Ortiz Jose Manuel: : 28027, Madrid, .: +34 913.203.371
  • : 27.12.1970 .., - .., : www.ok.ru+ , id : 73110598,
  • Mikshin Sema: : k.s?, Gta..., Zlatoyst - .., : ..., .: -, : , 1, , ..., : www.ok.ru+Mikshin Sema, : , ..., id : 73849466, : , ...,
  • : 01.02.1928 .., : , . .26 .3
  • : 09.04.1948 .., : , . .36
  • : 10.02.1935 .., : . 49
  • : 16.7 .., - .., : www.vk.com/id146565257.
  • : 16.07.1984 .., : ., , . , . , .4
  • : 09.05.1949 .., . (495) 2547477.
  • : .: 8 4232404659, : , , 17
  • : : www.ok.ru+ , id : 27970254,
  • : 06.05.1989 .., : , , -.( .).
  • : 19.08.1949 .., H .H - .., : (.: 24.12.2003 H-2 H . H) 130, .
  • : .: 8 9242562891, : , ; , 2
  • ò : : 3068621277, 06.01.1984 .., .ȯ - .., : , .ȯ
  • : 09.05.1961 .., : , . .4 .2
  • : 06101930 .., - .., : - ..
  • : 01.04.1975 .., , . .2 . 46, . (495) 5198449.
  • : 10.11.1970 .., : www.ok.ru+ , id : 73878032,
  • : 10.04.2008 .., : , , , 32
  • : 14.12.1950 .., : , . . 85, .: (495) 1311672
  • : : www.ok.ru+ , id : 73774807,
  • : : www.vk.com/id220700382.
  • : 30.01.1951 .., : , .
  • : 07.02.1962 - .., : , , 19302334, , , 25, : VOLKSWAGEN PASSAT, , M186LNM, WVWZZZ31ZME064477, 1990 ..
  • : 15.8.1993 .., : www.vk.com/id220962564.
  • : 04.04.1935 .., : , 1- . .21 .1
  • : 25.10.1960 .., - .., : www.vk.com/id220168054.
  • . : : www.ok.ru+. , id : 3165858, : https://vk.com/public62285382.
  • : - .., : , ..., : www.ok.ru+ , : , , , id : 73233028, : ,
  • : : , . . 12, .: (495) 2453806
  • : 11.5.1984 .., - .., : www.ok.ru+ , id : 3154960,
  • : 01.01.1935 .., : ., , , 19.
  • : . .: 8 9036587762, : . . 10
  • : 2.5 .., : sarebbe stato l',osso e la carne crescera , : /////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////, Pyatigorsk - .., : Coelho, Hemingway, Palahniuk, Haruki Murakami, .: 89283596322, : /////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////, : www.ok.ru+ , : //////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////, : NP_Standart, Riza, INtox, id : 73121368, : musica, sport, psicologia, Foto, Auto, Guns, Yoga, Girls, storia, astronomia, ecc q, : http://np-rec.atbhost.net/ !.
  • : . , - 1- . 13
  • : 06.01.1957 .., : 652811, , , ., . 35
  • : 22.02.1976 .., : , .
  • : : zheurov92@mail.ru
  • : .: 8 9146758548, : , , 16
  • Khodorovich Aleksandr: .: 80336669351, : www.ok.ru+Khodorovich Aleksandr, id : 73102351,
  • Ҳ ˲: : 2638622416, 29.03.1972 .., - .., : ,
  • : 18.11.1986 .., : (.: 06.12.86 HH . H) 9, .
  • Medvedev Misha: 19.5.1990 .., : =), : www.ok.ru+Medvedev Misha, id : 27718755,
  • : : www.ok.ru+ , id : 73554333,
  • : 01.05.1992 .., : ., , . , , .11
  • Ss Ooops: : www.ok.ru+Ss Ooops, id : 73584887,
  • : 1973 .., : , , , 21.
  • : 04.12.1970 .., . (495) 5541694.
  • : 21.8.1993 .., : www.vk.com/id146892622.
  • : - .., : www.ok.ru+ , id : 27913052,
  • : 30.9 .., : www.vk.com/id146597666.
  • : 01.01.1931 .., : , .
  • : : www.ok.ru+ , id : 3229789,
  • : 28.05.1982 .., : CHEREAU, , 837252, VM4CD381J1A010780, 2001 .., : , . 12
  • Biber Justin: 13.4 .., : www.vk.com/id221071484.
  • : : 2909320935, 27.08.1979 .., IJ - .., : , IJ
  • : : www.ok.ru+ , id : 27885205,
  • 4: : www.ok.ru+ 4, id : 73209401,
  • : 1958 .., : ., , , ,
  • : TOYOTA CHASER, (), , 14, 14, 45825, 1997 .., : , :
  • ²: : 3155815057, 27.05.1986 .., - .., : ,
  • : 01.01.1975 .., : ., . -, 5
  • Ssssssssss Sssss: .: ccccccccc, : www.ok.ru+Ssssssssss Sssss, id : 73437332, : cccccccccccccc.
  • Driel F: .: 104821564, : , , 3079PG, Rotterdam, Hazendijk, 151.
  • : 1948 .., : 23. :
  • ò : : 2912621676, 29.09.1979 .., ϲ - .., : ,
  • : : 3076822659, 28.03.1984 .., Ѳ - .., : , Ѳ
  • : 10.09.1962 .., : . .15
  • : 26.05.1967 .., : , .8
  • : 01.01.1957 .., : ., --, , 169.
  • 9065182154 PRE_PAY: .: 8 9065182154
  • : : www.vk.com/id146791496.
  • : : , 13 58
  • Co Goldin: : &,, : www.ok.ru+Co Goldin, id : 3272795,
  • : 06.08.1981 .., : , 70 , : 16.07.2002
  • : : www.ok.ru+ , id : 73119441,
  • : : www.vk.com/id220375068.
  • : : ., .28
  • : : www.ok.ru+ , id : 73460201,
  • : : 4331, 8438, , 1991 .., : 012067, 014036, : , .
  • : 05.05.1985 .., : , , .
  • : 25.03.1988 .., . , . .9
  • : 04.04.2003 .., : ,
  • : 25.04.1929 .., : . -, -, ., 19, .: (812) 2267118.
  • SUZHOU City LILIXIANG Food Factory: : QIAN,HUIMING, : roasted seeds and nuts, : , 215151, Jiangsu, Suzhou, NONGKE ZHANNEI, HUGUAN Town, .: (512) 5391178.
  • : 22.11.1998 .., : www.vk.com/id220390104.
  • : : 3116417357, 28.04.1985 .., ² - .., : , ²
  • : 18.11.1957 .., : , . .31
  • : 14.07.1979 .., : , , . .28
  • : : www.ok.ru+ , id : 73777964,
  • : : - --> , : Sky Express.
  • : 3.7 .., : www.vk.com/id221150798.
  • : 23.3.1981 .., - .., : www.ok.ru+ , id : 73300983,
  • ˲ : : 2754421450, 31.05.1975 .., - .., : ,
  • ..: , . . 28 ,
  • : 31.03.1978 .., : , , .( -).
  • : 20.02.1988 .., : ., . -, 6
  • : : , . .58 .3
  • () : : www.ok.ru+ () , id : 73816383,
  • : : www.vk.com/id220492284.
  • : 26.04.1960 .., : (), . , 2
  • : 02.08.1959 .., : , 368976,-
  • : : www.vk.com/id220176666.
  • : 10.09.1963 .., : , - 5922355100, , 10, : , 2108, 7556, 1986 .., : XTA210800G0032361.
  • : 18.08.1979 .., : , ., .9, .2,
  • : , . . 42 ,
  • : 05.04.1956 .., : , .19
  • Ϳ : 01.01.1949 - .., : , 1958000, 1958252, / 60 , /, /, : 21060, -, X006EUM, XTA210600Y4274546, 2000 ..
  • : 04.01.1947 .., : ., . -, 41
  • : : www.vk.com/id220107056.
  • Alieva Aydan: : www.vk.com/id220809702.
  • : 6.12.1969 .., : .: :., .: 666, : www.ok.ru+ , id : 3235733, : http://vzhope.ru/.
  • : : www.vk.com/id220353426.
  • : 10.6.1984 .., - .., : www.vk.com/id146721224.
  • : : . . 14, .: 9605397261
  • : : www.ok.ru+ , id : 73812613,
  • : 16.4.1993 .., : www.vk.com/id220241856.
  • : 03.10.1991 .., : , , - , 209.
  • . ""): .: 07.02.2005 ., : 3436107413, : 1053400000928, : 343601001, : 18415000000, : , : 403876, , -, , 5- , 37.
  • : 19.10 .., : www.vk.com/id220170679.
  • : 07.05.1920 .., : .,
  • ? ?: : www.vk.com/id220815679.
  • : 17.05.1922 .., : ., . -, 8
  • Ii Liu: : www.ok.ru+Ii Liu, id : 73155701,
  • : .: 8 9065361328, : . . 10
  • : 16.08.1933 .., : . -, -, ., 34, .: (812) 3416204.
  • 9601376290 PRE_PAY : .: 89601376290 (), : .
  • : 03.12.1944 .., : , 2- .11
  • JIANGYAN City HUAYU Coating & painting Co.,ltd.: : CHEN,GUOHUA, : motorcycle . refrigeratory . air-conditioner and spare parts and fittings static coating . powder paint manufacturing, : , 225531, Jiangsu, Taizhou, TAIYU Economy Development Zone.
  • : 13.08.1991 .., : . 182.
  • : : www.vk.com/id220607254.
  • : - .., : www.vk.com/id146638282.
  • A: : ., 2140 ( ) , - , 1981 .., : , : 74540, 412-3139071, 766085, 951789, :
  • : 20.05.1987 .., : ., , ., , .7
  • : : , , 01.06.1983 .. .3
  • : 10.4.2000 .., : www.vk.com/id220509548.
  • Ergalieva Gul',nur: : www.vk.com/id220262050.
  • Yixing TONGHE Gas Co.,ltd.: : HUANG,JIYUAN, : supply petroleum gas and supplying service, : , 214211, Jiangsu, Wuxi, HEQIAO Town, .: (510) 7802402.
  • : : www.ok.ru+ , id : 73712239,
  • : .: 8 9242457967, : , ; , 15
  • Ibragimov Roman: : texaskiy poker, biliard, gorod vetrov - .., : detektiv, : kryostniy otec, : www.ok.ru+Ibragimov Roman, : jestokie igri, : lube, id : 73384971, : azartnie igri, sport, otdix na prirode,
  • : The Smile Centre, 8513, Hospitals & Medical Establishments, Dentists, : , , 90 Walsgrave Road, Coventry, West Midlands, West Midlands, CV2 4ED, CV2 4ED, West Midlands, West Midlands, Coventry, .: 442476453850, : Mr R Osmond (Principal)
  • : 27.05.1951 .., : , 428, , ., 10
  • : 30.09.1977 .., : .66
  • IJ ò : : 3080121358, 30.04.1984 .., - .., : ,
  • : 22.6 .., : www.ok.ru+ , id : 27815393,
  • RUDONG County HUANGHAI Student Sports ware Factory: : CHEN,YAFEI, : student sports ware , fitness equipment processing and marketing ., : , 226412, Jiangsu, Nantong, No. 57, RENMIN BEI Road, BINGFANG Town, .: (513) 4501070.
  • : 1.10.1987 .., : www.ok.ru+ , id : 27824199, : .
  • : .: 8 9066236014, : . . 2 .-
  • : 11.02.1997 .., : , 452990
  • : 03.10.1995 .., : , . .10
  • : .: +79069289089, +73844271992, : 652380, , -, ,
  • : 28.10.1992 .., , . . 3, . (495) 2765619.
  • 11.06.1994 ..: : ., . .16
  • : 16.09.1991 .., : , , , 20.
  • : 22.01.1930 .., : ., - 310, : 412, 514978, 1977 .., : 412-1674761.
  • : 22.10.1990 .., - .., .: +7 775 215 01 11, : altysha_90, : www.vk.com/id220816702.
  • It-Not-I Oops: : www.vk.com/id220063203.
  • : , .16 . : : , : 19.05.1961, : 2, :
  • : : ., . -, 23
  • : 8.7.1992 .., : www.vk.com/id220215357.
  • : : www.vk.com/id220828013.
  • : . , ., ., 82
  • : .: 8 9092782509, : . . 11
  • Kaulitz Billik: : (), : www.ok.ru+Kaulitz Billik, id : 73190900,
  • : : , : www.ok.ru+ , id : 73546852,
  • : 7.8 .., : www.vk.com/id220335558.
  • : 22.03.1953 .., : , 10
  • : 05.06.1963 .., : , , .
  • : 14.07.1962 .., : , ., - 6, 6
  • SUZHOU City No. 4 Middle school XIAO: : XIAO,TIANREN, : education, : , 215003, Jiangsu, Suzhou, No. 8, BAOCHENGQIAO Street, .: (512) 7274818.
  • : 31.5 .., : Demon, - .., : www.ok.ru+ , id : 3136995,
  • : . .: 8 9065258663, : . . 9 6
  • : .: 89269669193, : www.ok.ru+ , id : 73130757, : .
  • : .: 8-921-2595124 (), : ., , , 55
  • : 18.06.1940 .., : - , .
  • : .: 94372, : , . , . .
  • : : www.ok.ru+ , id : 27749232,
  • : : www.vk.com/id220833764.
  • : 07.11.1949 .., : , .
  • : 08.11.1983 .., : , .76 .2
  • : TOYOTA CROWN, (), , , , 81125, 1998 .., : , :
  • : : www.ok.ru+ , id : 3219919,
  • Bsdabdsabdsa Sadbsdabsda: : www.ok.ru+Bsdabdsabdsa Sadbsdabsda, id : 73677680,
  • : 7.8.1990 .., : , : , - .., : , : , : www.ok.ru+ , : , : , id : 27996291, : ,
  • : : www.vk.com/id220365146.
  • : 28.07.1957 .., :
  • : .: 8 9242420316, : , , 79
  • : 14.06.1987 .., : , . . .23
  • : 3.2.1983 .., .: 8923339...., : www.ok.ru+ , id : 73731954, : ............
  • : : www.ok.ru+ , id : 73400257,
  • : 01.01.1951 .., : ., --, , 21.
  • : 29.06.1969 .., , . . 15 . 2, . (495) 3019856.
  • : : www.ok.ru+ , id : 73217251,
  • : 23.9.1991 .., : www.vk.com/id221143791.
  • : 14.11.2000 .., .: 375291461207, : www.vk.com/id146703351.
  • 15.09.1959 ..: : ., . 50 .17
  • : : www.vk.com/id146617791.
  • Aa Aa: : www.ok.ru+Aa Aa, id : 73162822,
  • : : www.vk.com/id221117845.
  • Concato Enrico: 13.11.1974 .., : www.vk.com/id220133036.
  • : 28.10.1984 .., : 41. : . " ".
  • : 9.7.1996 .., : -, : S.T.A.L.K.E.R C-S 1.6 WoW, - .., : S.T.A.L.K.E.R, : Russia , : www.ok.ru+ , : , , id : 73797281, : !!!,
  • : 16.07.1932 ..
  • "SAS KIABI EUROPE" - , : 59510 . 100, : "", : 127051, , ., , .25, .3, : - 8(495)411-94, : , , : , : 91% 9% : XXL ( 168), :169486, FL756 - 2 ; : 84 2000, , : 91% 9% , - SAS KIABI EUROPE, WALK & TALK, K.WOMAN (GREY LABEL)
  • : : www.ok.ru+ , id : 73679346,
  • : 19.11.1975 .., : (.: 3476335261).
  • : .: 8 9038566208, : 394011 . . 28 .
  • : 8.8 .., : www.vk.com/id221034702.
  • : 05.07.1927 .., : , . .1 .1
  • : - .., : www.ok.ru+ , id : 3262383,
  • K?l?caslan Oktay: : www.vk.com/id220156400.
  • : 29.04.1990 .., . (495) 2378159.
  • -: .: +7 (495) 989-40-73, : , . , 38/25, : , , ,
  • : 23.04.1958 .., . - - .., .: ()
  • : : www.ok.ru+ , id : 73150296,
  • Ch Nawaz-Ch: : www.vk.com/id220155479.
  • Sathiyapama R: : -, Urelai Rd Thunnalai North
  • Rahimich Dovlet: : www.vk.com/id220579756.
  • : : www.vk.com/id220144181.
  • Love Evgen: : www.vk.com/id220116636.
  • : 02.06.53 .., : , , ., . , 42. : "", 454079, - , 1
  • : Ambit Services Ltd, 1731, Electrical Work, General Electrical Contractor, : , , Longney, Bow Lane House, Gloucester, Gloucestershire, South West, GL2 3SW, GL2 3SW, South West, Gloucestershire, Gloucester, .: 441452883106
  • : 30.11.1967 .., : www.vk.com/id146714275.
  • : 14.12.1967 .., : , , , 5
  • : 05.07.1991 .., . , . .4
  • ˲: 11.11.1911 .., : , - 5624655700, ., ., : JAWA, 350 634, 8799, 1988 .., : 0.
  • : 16.10.1936 .., : , . .4
  • : : , . . 3, . (495) 1411448.
  • : .: 8 9146580194, : , ,. , 21
  • - : : www.vk.com/id221054143.
  • Dijk S P: .: 251657605, : , , 1902RM, Castricum, Breedeweg, 52.
  • : 1.11 .., 05 26 07 - .., : alihka-dag, : www.vk.com/id220828026.
  • ..: : , . . 14 ,
  • : . .: 8 9069873244, : . . 18
  • "" 0 1037705032430: ./: 3072698, 0, : 109044, , , 24, 1
  • : : , . . 20, . (495) 4127917.
  • : 20.11 .., : www.vk.com/id220221877.
  • : : www.ok.ru+ , id : 73464891,
  • : 24.11.1967 .., : . , ., 20. : "", : , 680013 . . 75-325, : , .: 49-50-03.
  • : 20.11.1964 .., , . . 11 . 7, . (495) 4807173.
  • : : www.vk.com/id146520511.
  • : 19.01.1956 .., : ., .- - 15, .: 8 (812) 5420264, : 21053, 29478, 1998 .., : XTA210530W1781232, 2103-5246710.
  • : 13.01.1974 .., : , . .69
  • : 10.12.1942 .., : ,
  • Croes P: .: 227511247, : , , 1779BL, Den Oever, Breehornstraat, 2.
  • ò : : 3166114034, 07.09.1986 .., Ͳ - .., : , Ͳ
  • : : ., , , .: 8 (3519) 326658
  • : 20.08.1933 .., : , , ., 9
  • : 1951.02.10 .., : ., -, ., , 20, : 21013, , 22236, , 1989 ..
  • : 05.01.1938 .., : , , /, , 11
  • : : www.vk.com/id146623814.
  • : 28.01.1945 .., : , , , 21
  • : 050671 .., : ., - 1 .4, : 2102, 85164, 1973 ..,
  • 9 110 76: .: 8 (343) 760255
  • : 05.05.1963 .., : , , 3- -, 3 : .
  • Asdas Asdas: : www.ok.ru+Asdas Asdas, id : 73646367,
  • : - .., : www.vk.com/id221087610.
  • : 6.3.1989 .., : , : www.ok.ru+ , id : 27734991,
  • : : natalya.cherepanowa@yandex.ru
  • : 23.3 .., : www.vk.com/id220420755.
  • : : , , , , , : 93866-021, -, 1438PD, , 2002 ..
  • ˺: 8.3.1995 .., : www.vk.com/id220112799.
  • : 12.03.1974 .., : , . .14 .1
  • : : www.ok.ru+ , id : 73502300,
  • : 02.12.1973 .., : --, . 99
  • : - .., : www.ok.ru+ , id : 73878020,
  • : 20.7 .., - .., .: 8920556****, : superslava49, : www.vk.com/id146893193.
  • Ը : 12.1 .., : www.vk.com/id146937863.
  • "" ( "): .: 19.08.2011 ., : 3666103445, : 1033600031519, : 366601001, : 20401390000, : .2 .21.1 08.08.2001 129-, : 394000, , , , 6.
  • : : ., . -, 6
  • : 30.7.1981 .., - .., : www.vk.com/id146855276.
  • : 24.02.1969 .., : , .
  • : 05.03.1931 .., . (495) 5570050.
  • : 19.09.1951 .., : , , , , 10. : - ,
  • : 09.10.1951 .., : , . . 17, .: (495) 9035787
  • : .: 89264522525, : www.ok.ru+ , id : 73727484,
  • : 25.11.1990 .., : ., . -, 5
  • : 17.07.1985 .., :
  • : 09.07.1937 .., , . . 25, . (495) 3086512.
  • : 020268 .., : ., .7 .1, : 3507, 57864, 1989 .., : ___350700K1211401.
  • : .: 8 9025217590, : , 2441
  • 3 : .: 8 (921) 9342707, (095)7847474, (095) 7847474, : , 24/
  • : 24.1.1994 .., : www.vk.com/id146540495.
  • : 21.07.1962 .., , , . - .., : 23 1.
  • : : www.ok.ru+ , id : 28053113,
  • : 9.12.1992 .., : WoW, , , , - .., : , .: +79096032791, : . . , : www.ok.ru+ , : ))), : , id : 73723597, : , , ) ,
  • Ivanova Darya: 31.1.1986 .., : www.ok.ru+Ivanova Darya, id : 3208471,
  • "" ( " "): .: 16.02.2011 ., : 6221000352, : 1026200622535, : 622101001, : , : 391192, , -, .
  • : 22.11.1949 .., : , - . . 23, .: (495) 2863632
  • : : www.vk.com/id220173638.
  • Page L R: : -, 7, 11/2 Barnes Pl Colombo 07
  • Memmedov Sahid: : www.vk.com/id220446606.
  • : 9.10.1999 .., - .., : www.vk.com/id220873894.
  • : : www.vk.com/id146709299.
  • 17.04.1977 ..: : ., . .55
  • : 14.03.1977 .., : , . .13
  • Rasulova Karina: : www.vk.com/id146537132.
  • : 01.01.1938 .., : ., --, , 25.
  • : . , . .11 .1
  • : 30.03.1977 .., : , , (-44).
  • : 08.05.1946 .., : , , , -, , 6 , 28, : 21110, , --, 19163, 21110020132893, 0132893, 0684044, 2002 ..
  • : : , : olga.sunczova@mail.ru
  • : : www.ok.ru+ , id : 3129490,
  • : 07.10.1943 .., : , , ( -).
  • Meherremov Ramin: : www.vk.com/id221009064.
  • IJ: : 3111514950, 10.03.1985 .., Ͳ - .., : , Ͳ
  • " 14" ( " 14"): .: 21.03.2003 ., : 1036405104856, : 63401368000, : , : 410055, , , , 108.
  • : . , ., ., .4, .2, .
  • : : www.vk.com/id220899379.
  • : 18.11.1986 .., : www.vk.com/id220328284.
  • : 08.01.1956 .., : 95023, , , .ѳ, ., 59.
  • : - .., : www.ok.ru+ , id : 73543871,
  • : 02.10.2007 .., : , : , .
  • ZHANGJIAGANG City QIANGSHENG Metallic doors & windows Factory: : SHA,YAFEI, : , 215621, Jiangsu, Suzhou, DONGXING Village, LEYU Town.
  • : : www.ok.ru+ , id : 73832334,
  • : , . . 17 . 4 9,
  • : 21.09.1992 .., : , , , 18 18.
  • : : www.vk.com/id146900554.
  • : .: +38097895467, : , 5
  • : .: 8 9065180222, : . , . 10- , .3, .-
  • Pelageya1986: : gaya9425@mail.ru
  • : - .., : www.vk.com/id221058260.
  • : 14.07.1942 .., : . 64. : " ".
  • : - .., : www.vk.com/id146486058.
  • : : www.ok.ru+ , id : 73784704,
  • Kissa : 13.7 .., - .., : www.ok.ru+Kissa , id : 73681895,
  • : 15.6 .., : <,<,=?k?@?R>,>,, .: ***********, : www.ok.ru+ , id : 73482243, : Nicolandrgv.narod.ru.
  • : : 2051627853, 03.03.1956 .., - .., : ,
  • : 24.11.1971 .., : , .
  • : : www.ok.ru+ , id : 73149988,
  • : 07.01.1954 .., : , 40
  • : : , - .., : www.ok.ru+ , id : 73305260,
  • : : www.vk.com/id220460448.
  • : : www.ok.ru+ , id : 73164276,
  • : : , . . .7
  • : 17031971 .., : ., .3, : 2106, 26664, 1984 .., : XTA210630E1054302.
  • : 07.02.1954 .., , . . 88 . 2, . (495) 1311958.
  • : 26.03.1930 .., : , . . 18 . 2, .: (495) 9451851
  • : : , : , : , : , : www.ok.ru+ , : , : , id : 73140272, : ,
  • : 12.10.1948 .., : .,
  • : 07.04.71 .., : , , ., 69. : "", 454006, ., 65
  • : 17.05.1984 .., : ., . -, 53
  • ղ : : 3072920276, 18.02.1984 .., - .., : ,
  • : : www.ok.ru+ , id : 73744729,
  • : 23.10.1948 .., : ., , . , 2 , .27
  • : : www.ok.ru+ , id : 73765581,
  • : 21.10.1954 .., : ., . -, 44
  • : : www.vk.com/id220668671.
  • Kirim Kaan: 7.12 .., : www.ok.ru+Kirim Kaan, id : 73687410,
  • : 19.9 .., : www.vk.com/id146778569.
  • : .: +79203154406, +74815523559, : 216598, , -,
  • Ͳ : : 2215927452, 01.09.1960 .., ² - .., : , -
  • : 10.1.1994 .., : , .. ... ... , : >,Orlando d',Ark<,, : : , , , +) : Warhammer 40000, Starcraft, StarWars ( , ), jon richmond, - .., .: ..., : StarWars , - , - , : www.ok.ru+ , : - ... ... - , : , , id : 28034988, : , ... , , jon richmond,
  • : : ., . -, 37
  • : 7.8.1994 .., : www.ok.ru+ , id : 3110220, : http://www.formspring.me/BeneskoVitalik.
  • "" 19 (2000.02.01 =5753024000): .: 8 (473) 27495749
  • : : www.vk.com/id221033862.
  • : 30.9.1993 .., - - .., : www.vk.com/id220061559.
  • ³ : : vut6ok1992@spaces.ru
  • ( .): 08.11.1972 .., : / ., ; /"",, : . - . 23; - . . 23
  • : 29.11.1973 .., : , - 5620881502, 0, 0, : MERCEDES-BENZ, 240, 8893, 1979 .., : 12312310109581.
  • : 16.03.1970 .., : , . 62
  • : : , , . , , ., : , - .., : , .: 8923*35*9*8, : , : www.ok.ru+ , : , , , , ., : , id : 73764273, : , , ,
  • : : www.vk.com/id220307892.
  • "" ( ): .: 14.07.2010 ., : 6166006784, : 1046166003487, : 616601001, : 60401378000, : .2 .21.1 08.08.2001 129-, : 344045, , -- , , 01.05.2013.
  • : 28.11.1964 .., : , . . 41, .: (495) 4571274
  • : 14.05.1976 .., : , , , 29.
  • : 13.8.1995 .., : , : www.ok.ru+ , id : 27933502,
  • : .: 8 (812) 3520256, .: 9934338 (Tele2), : , -, / 214 -------- --------
  • "-16" - "-16": , : 840000 ., : - , : 0, : 50898408, : , , , : 196086, 196086.
  • : 01.04.1953 .., : ., , . , , .9
  • : 18.9.1989 .., - .., : www.vk.com/id146750142.
  • : 16.02.1936 .. : . : . ""
  • : 11.04.1954 .., : , , ( -).
  • : : stankevich_ira@mail.ru
  • ..: .: 8 (8442) 396249, : . , 30 35
  • г : : www.vk.com/id219999743.
  • : 28.5.1986 .., .: 89172896768, : rr79872352810, : www.vk.com/id220890136.
  • : 10.01.1965 .., : - 12, , . : " " ".
  • : 23.08.1982 .., : ,
  • : 15.9.1993 .., : !, : www.ok.ru+ , id : 73317179,
  • : 4.7.1989 .., : www.ok.ru+ , id : 73844693, : http://.
  • Litovkin Vlad: : www.ok.ru+Litovkin Vlad, id : 73579250,
  • 12 : : www.vk.com/id146836865.
  • EXPOLOG SRL - , : 20122 MILANO VIA RUGABELLA 10, : ""/"-2014"/-2014, : 123100, , , .,.7,.1, 4, : - (985)761-98-, : - : , , -40 - -:"CENTREXPO SPA", CENTREXPO,,
  • : 1989 .., : , .
  • : The Salvation Army, 9131, Places of Worship, Places Of Worship, : , , Lavenham, The Cottage, The Common, Sudbury, Suffolk, Eastern, CO10 9RL, CO10 9RL, Eastern, Suffolk, Sudbury, .: 441787247712, : Maj Wendy Goodman (Manager)
  • : 26.01.1977 .., : 652617, , -, , , ., . 50
  • : - .., .: +79803015040, : www.vk.com/id146809484.
  • Rthrhrh Rtrrh: : www.ok.ru+Rthrhrh Rtrrh, id : 73332133,
  • Akkurt Yusa: 8.8.1994 .., : www.vk.com/id220424378.
  • : : , .: 6616221.
  • : 23.11.1993 .., : - , ., ., 21
  • : : www.vk.com/id220344623.
  • : 11.05.1967 .., : , ., . , 58
  • : 14.11.1959 .., : , .
  • "" - "": , : 840000 ., ./: 142-14-87, 142-14-87, : - , : 7805107334, : 48936751, : , ; , : 198215, 198215, 142-14-87.
  • : 24.08.86 .., : , , -., ., 10
  • : 5.3.1999 .., : www.vk.com/id220378819.
  • Rai Alexandra: : www.vk.com/id220068423.
  • : 15.7 .., - .., : www.ok.ru+ , id : 73438379,
  • : 07.12.1965 .., : , - 5640100000, , 14, : , 5312, 4409, 1983 .., : 0, 0793245.
  • : - .., : www.ok.ru+ , id : 73584902,
  • 777 : : www.ok.ru+777 , id : 73470981,
  • : 28.01.1989 .., : , -, , 8.
  • : 22.04.1953 .., : ., .- - 43, : 3, 8320, 1990 .., : 0737.
  • : 4.2.1989 .., : www.ok.ru+ , id : 73197307,
  • : : 1769015350, 07.06.1948 .., ײ - .., : , ʲ
  • : 25.2 .., : www.vk.com/id220473850.
  • : 14.5 .., : www.vk.com/id220518179.
  • : : www.ok.ru+ , id : 3200752,
  • : 12.04.1983 .., . , . .25
  • : 31.08.1983 .., : . 114
  • : 03.05.1962 .., : , .
  • : 20.10.1941 .., : , , .( -).
  • : 20.3 .., : <,Suhopleshenko>,, : www.ok.ru+ , id : 73831717,
  • : 01.01.1900 .., : , - 5920986801, ., ., : , 311212, 3909, 1991 .., : 0, 183417.
  • : 07/17/86 .., : ., . , 11860, 1
  • : 30.10.1930 .., : , . .39 .2
  • : 02.06.1947 .., . , 13 40
  • : : www.ok.ru+ , id : 73147490,
  • Adadaa Dadada: : www.ok.ru+Adadaa Dadada, id : 73078665,
  • ..: : ., , 3 7, .: 8 (49657) 39778
  • Gavajuc Mariana: 13.7 .., .: 068166402, : mariana.gavajuc, : www.vk.com/id220883048.
  • Orcle Blind: .: dfsf, : www.ok.ru+Orcle Blind, id : 73838643, : sdf.
  • : 02.10.1958 .., . - .., : , , 22.
  • : 17.11.1980 .., - .., : , : www.ok.ru+ , id : 73518057, : !!!!,
  • : : www.ok.ru+ , id : 73589545,
  • South field manufacture barracks: : , Hokkaido, www: do-oh.com/nanbara/, do-oh.com/nanbara/, nandara@seagreen.ocn.ne.jp, : Business and Economy/Shopping and Services/Home and Garden/Home Improvement/Repair and Improvement/
  • : 11.05.1986 .., : , , .
  • : : www.vk.com/id220581149.
  • Siniy Serega: 25.6.1984 .., : www.ok.ru+Siniy Serega, id : 3251029,
  • ֲ : : 3110017399, 23.02.1985 .., ֲ - .., : , ֲ
  • : 03.10.1930 .., : ., , .
  • : 27.06.1997 .., . , . .11 .3
  • : 06.04.2004 .., : , .
  • : , .31/187 . : : , : 21.06.1993, :
  • : 25.05.1993 .., : ., .42
  • : 08.03.1959 .., : , .
  • : 12.03.1949 .., : , . . 11, .: (495) 3975822
  • : Thomas C Adams, 7031, Office & Administration, Estate Agents, : , , Little Sutton, 388 Chester Road, Ellesmere Port, Merseyside, Merseyside, CH66 3RA, CH66 3RA, Merseyside, Merseyside, Ellesmere Port, .: 441513391791, www.thomascadams.com, : Mrs J Howarth (Manager)
  • : 17.08.1986 .., : , , , 27, : 21043, 319199, 2005 .., : XTK21043050032810.
  • Melnikov Nikita: : www.vk.com/id220506776.
  • : 01.06.1985 .., : , .
  • : 20.06.1951 .., : , , 1 .16
  • : 01.01.1963 .., : ., .,
  • : 7.1 .., : , - .., : , : ., : www.ok.ru+ , : , : , id : 3115694, : ,
  • Shirokova Lexa: : www.vk.com/id220065177.
  • : The Ultimate Event Co, 9234, Head Office, Corporate Entertainment, : , , 46-48 London Road, Twickenham, Middlesex, London, TW1 3RJ, TW1 3RJ, London, Middlesex, Twickenham, .: 442088914000, www.ultimateevent.co.uk, : Mrs S Martineau (Managing Director)
  • Aida Moonlight: : www.ok.ru+Aida Moonlight, id : 73286352,
  • : 07.10.1952 ..
  • : .: 8 9241078850, : , 12 ;, 104
  • в : : 3507001036, 07.01.1996 .., - .., : ,
  • DANYANG City Supply and marketing Cooperation Head Office Market Consume electronics Service: : ZHU,JIANZHONG, : home appliance service , spare parts of household electrical appliances retail, : , 212300, Jiangsu, Zhenjiang, West Side, GUOPIN GONGSI, ZHONGSHAN Road, .: (511) 6508295.
  • A: : ., 412 ( ) , - , 1991 .., : , : 50040, 34899, 412-6836501, M0251229, M0251229, XTK4120M0251229, :
  • : 18.03.1974 .., : , , , , 5, : ZREMB CN181E, 7751, 1998 ..
  • : : www.ok.ru+ , id : 73556648,
  • DONGTAI City XINJIE ZHOUYANG Passenger transport Station: : ?,MINGSHENG, : road automobile passenger transport ., : , 224234, Jiangsu, Yancheng, ZHOUYANG Village, XINJIE Town.
  • ..: : , . . 23 . 2 ,
  • : , 15, .: 8 (3812) 213747.
  • : .: 8 (921) 6471790, 5838783, 5838783
  • : 10.12.1948 .., : , . .3 .2
  • : 01.01.1942 .., : ., , (), 122.
  • : - .., : www.ok.ru+ , id : 3211273,
  • Gfsjhghjhj@rambler.ru Gfsjhghjhj@rambler.ru: : www.ok.ru+Gfsjhghjhj@rambler.ru Gfsjhghjhj@rambler.ru, id : 73278949,
  • : : www.ok.ru+ , id : 73841484,
  • : 5.5 .., : www.ok.ru+ , id : 73582556,
  • : .: 89636398263 - , . =) ( , Acer 5220g , , , : 2000 .), : , .
  • Ustugova Marina: : www.vk.com/id220690281.
  • : 14.10.1992 .., : , , - .., : ,-), .: , : !!!!!!, : Dubanbest, : www.ok.ru+ , : .., : ... e , id : 73680686,
  • : 10.5.1982 .., : www.ok.ru+ , id : 73797247,
  • : 15.04.1985 .., : , . . 2 . 4, .: (495) 2869348
  • : 01.05.1942 .., : ., --, , 35.
  • : : www.vk.com/id220201300.
  • : 3.7 .., : www.vk.com/id221156727.
  • : 5.11 .., : www.vk.com/id146558426.
  • H ( .): 02.01.1976 .., - ..
  • : 01.02.1971 .., : , . .24 .1
  • : .: 8 9609229179, : . . 111
  • Ը: .: 89609128427 (), : 650070 . . 38 .3
  • Hfxghgf Gfhjf: : www.ok.ru+Hfxghgf Gfhjf, id : 73838518,
  • : : www.vk.com/id220687563.
  • : 03.09.2002 .., : , , .(- -).
  • : 10.11.1954 .., - .., : www.vk.com/id220586801.
  • : 15.4 .., .: , : www.ok.ru+ , id : 73154038, : http://south-park-online.com.ua/load/2_sezon/2_serija_2_sezon_mamasha_kartmana_po_prezhnemu_grjaznaja_shljukha/2-1-0-16.
  • : .: 8 9609124108, : 650000 . - 25 .
  • : 06.09.1957 .., . , . .1013
  • : 02.06.1968 .., : , , -, 133
  • : .: 8 9502825005, : , , , 13
  • : : . 16, .: 8 (383) 2363244.
  • : 09.07.1942 .., : , . . 8, .: (495) 4784500
  • : 15.3.1995 .., : www.vk.com/id220855066.
  • : : www.ok.ru+ , id : 3127409,
  • ..: , . . 29 ,
  • : : www.vk.com/id220260501.
  • ? ?: - .., : www.vk.com/id220040200.
  • : 28.09.1958 .., : 8122, 053802, , 1992 .., : 12073, : , , , 11.
  • : 23.02.1986 .., . , . .35/58
  • : : www.vk.com/id220642666.
  • : 1964 .., : , , 120.
  • : 06.02.1974 .., : , . .3 .2
  • : 03.08.1990 .., . , . .157 .2
  • : Lothian Buses, 6021, Head Office, Bus & Coach Operators & Stations, : , , Annandale Street, Edinburgh, Midlothian, Scotland, EH7 4AZ, EH7 4AZ, Scotland, Midlothian, Edinburgh, .: 441315556363, www.lothianbuses.co.uk, : Mr N Reynoldson (Chief Executive)
  • : 16.9 .., - .., : www.vk.com/id220948165.
  • Algazale Mohamed-Algazale: : www.vk.com/id220791064.
  • : - "". : , , 11. : 200-39-42. : 205000 .
  • Ѳ : : 2458619535, 25.04.1967 .., ² - .., : , ²
  • Amelia Ma: : www.vk.com/id146660205.
  • : : 711502359, 25.06.1919 .., - .., : ,
  • : . .: 8 9050535060, : 396160, . , . , .33
  • : 27.02.1986 .., : , - , , 17.
  • : 07.03.1942 .., , . . 3 . 7, . (495) 1913722.
  • - : 31.07.1965 .., : , 3
  • Skazio Shuffleshare: : www.ok.ru+Skazio Shuffleshare, id : 73872339,
  • : 22.11 .., : www.vk.com/id221066880.
  • Ͳ Ͳ: : 2234925997, 10.03.1961 .., - .., : ,
  • : 01.01.1955 .., : , , , , 17. : "-3" , : , . 26,
  • : 16.06.1982 .., : , , , 16 : - " " .
  • : , 1- . . 3 ,
  • Kuttymuratova Gulnar: : www.vk.com/id221142477.
  • : 22.9.1985 .., : Mitsu, : www.ok.ru+ , id : 3166552, : http://www.yesterdayme.ru/.
  • : 03.09.1995 .., : ., , , .4 .23,25
  • Norges : : www.ok.ru+Norges , id : 27718955,
  • : : www.vk.com/id221154134.
  • () : 7.12.1965 .., : _________________, - .., : , : , , , : www.ok.ru+() , : , : , id : 28053323, : --------------.
  • : 11.4.1935 .., : www.ok.ru+ , id : 27830621,
  • : .: +79227445731, +73514323306, : , 457678, , -, ,
  • : 01.01.1972 .., : , - 5640700000, , 50, : TOYOTA, CARINA, 68773, 1995 .., : SB153ABK10E004804.
  • : 08.09.1990 .., : , .
  • : : www.vk.com/id220842759.
  • : : www.vk.com/id219977362.
  • : 18.02.1961 .., : , . .9
  • : 29.05.1984 .., : ., . -, 11
  • : : www.ok.ru+ , id : 73835451,
  • Spigt D M: .: 756425029, : , , 1531GS, Wormer, Kees Jongensstraat, 2.
  • : : , . .2 .4
  • "" 7722620905 1077759163448: ./: 7695756, 0, : 111020, , 2-, 4, .12
  • : 1930 .., : , -
  • ZHANGJIAGANG City YANGSHE XINGDA Metal decoration Materials Store: : LI,ZHENGXING, : hardware sundry goods, : , 215600, Jiangsu, Suzhou, No. 71, HEXI, YANGSHE Town.
  • : 23.08.1994 .., :
  • ..: : , , 194, .: 8 (846) 9563756.
  • *** ***faberlicedelstarinfinum: : www.vk.com/id146750387.
  • : 29.5 .., : www.vk.com/id221057035.
  • : 29.10 .., .: ***, : www.vk.com/id146940445.
  • : 26.01.1931 .., : 67, 9878, , 1982 .., : 481684, : , , , 54.
  • Ҳ : : 2888422174, 30.01.1979 .., Ѳ - .., : , Ѳ
  • : . .: 8 9039445420, : 26-92
  • YIXING City CHENSHI Environment protection Co.,ltd.: : CHEN,LIFENG, : equipment for environmental protection , tempered glass products manufacturing, : , 214214, Jiangsu, Wuxi, GAOCHENG Town, .: (510) 7891986.
  • : : www.vk.com/id146773721.
  • : 17.12.1987 .., : , , . , 50
  • : : www.vk.com/id220893268.
  • : 26.06.1950 .., : --, . 59
  • : ..: 8 9093069604, : , 420095, . , . . , .41
  • : : www.vk.com/id220784632.
  • : : www.vk.com/id220211500.
  • : : www.vk.com/id220060871.
  • Fe Fe: hrdfhhr - .., : www.ok.ru+Fe Fe, id : 73604995,
  • : 13.04.1972 .., , 5- . 1 5- . 1, . (495) 3553510.
  • Harut Harut: : www.vk.com/id220671464.
  • : 23.7.1991 .., .: 8-908.....,8-915....., : www.ok.ru+ , id : 73603096,
  • : 02.03.1980 .., : , , , 50.
  • : - .., : www.vk.com/id146922140.
  • : 01.05.1955 .., : , .
  • : : www.ok.ru+ , id : 73702695,
  • - : 28.01.1950 .., : , 9- . .9
  • : 27.12.1967 .., : ., -, ., . 63
  • : 14.01.1962 .., , . . 22, . (495) 2836226.
  • : 25.1.1997 .., : www.vk.com/id220154572.
  • : 02.02.1956 .., : , - 5640700000, II, 29/2., : AUDI, 100, 32820, 1988 .., : WAUZZZ44ZDN118448.
  • : 01.09.1966 .., : . -, -, ., 12
  • : 11.08.1987 .., : , . .5 .3
  • ³: : www.ok.ru+ ³, id : 73310353,
  • : : www.vk.com/id220397750.
  • : 1942 .., :
  • Mih Natasha: : www.ok.ru+Mih Natasha, id : 73272142,
  • : 17.02.1958 .., : , ., ,1
  • : 09.07.1968 .., : , 4- .1
  • We-Bas Rora: : www.vk.com/id221092745.
  • : .: 8 9145872488 - , : ., 676306 2
  • ( .):
  • Sakine Meiko: 9.4.1997 .., Tokyo - .., : www.vk.com/id220512708.
  • Suzhou People Televise Transmitter-receiver Union Committee: : LU,JING, : vindicate workers legitimacy rights and interests , construct workers troops , raise workers stuff, : , 215006, Jiangsu, Suzhou, No. 4, GONGYUAN Road, .: (512) 5211146.
  • : 16.05.1938 .., : , , , 17
  • : 05.05.1930 .., : 21251, 8913, , 1988 .., : 0168330, 6076623, : , , 19.
  • : :
  • : 19.9 .., - .., : www.vk.com/id146546625.
  • : 22.10 .., : www.ok.ru+ , id : 73425875,
  • : .: 8 (921) 9625445, 2989964, 2989964, : , 25- 52
  • : : www.ok.ru+ , id : 73461637,
  • Kydyrbayeva Zhanar: : www.vk.com/id220471639.
  • : 08.04.1932 .., : , . .3
  • : : www.ok.ru+ , : The medic droid, id : 73546687,
  • : : ..., - .., : ) ), : ..., : www.ok.ru+ , : ), : ), id : 73066875, : ...),
  • : : www.vk.com/id220341654.
  • : DAIHATSU MIRA, (), , , -1, 86325, 1985 .., : , :
  • ² : : 2674820476, 26.03.1973 .., Ͳֲ - .., : , Ͳֲ
  • : .: 8 9502900245, : , , , 78
  • : : www.vk.com/id220618829.
  • : 6.12 .., : www.vk.com/id221161605.
  • : - .., : www.vk.com/id220751646.
  • : : www.ok.ru+ , id : 73351369,
  • : 17.02.1964 .., : , . .1/5
  • : 2.8 .., : ?, : www.ok.ru+ , : nekish, id : 27907734,
  • : : www.vk.com/id221177698.
  • - 15.12.1934 ..: : ., .
  • : : , , ,, : www.ok.ru+ , : , id : 73369184,
  • Oskemen Outpac: - - .., : www.vk.com/id220750861.
  • : 14.04.1995 .., : , ., 10
  • : 02.03.1975 .., , . . 29, . (495) 3564624.
  • : 12.8.1998 .., - .., .: 380993777884 380936, : www.vk.com/id146558877.
  • : 19.09.1963 .., : , . .18
  • : DAIHATSU MIRA, (), , , , 0132, 1982 .., : , :
  • : 16.03.1965 .., . -H H - .., : , , 15.
  • : : ., .- - 19, : 350, 8272, 1940 .., : 173929.
  • : : , . .41 .2
  • : 1990 .., : , .
  • : 9.5.1945 .., .: , : www.ok.ru+ , id : 73695222,
  • ( .): 06.11.1906 ..
  • : 28.09.1982 .., : , 368736,-
  • : 12.5.1990 .., : , : www.ok.ru+ , id : 3286055, : http://orilider.com/?i=9767.
  • : 1.1.1985 .., - .., : www.vk.com/id220270580.
  • : .: 89652018428 - ( , porter 2012, , : , : 30000 .), :
  • Dolgopolov Alexander: : www.ok.ru+Dolgopolov Alexander, id : 73454329, : http://sprashivai.ru/New_Devils.
  • : 26.12.1963 .., : , , , , , 11
  • : 19.06.1978 .., : , . .1
  • : .: 8 9246621834, : , ;, 40/7
  • : 11/02/86 .., : ., . , ( , 14
  • : 27.10.1987 .., : , - , .
  • : 14.11.1955 .., : .
  • : 29.04.1949 .., : " ", : ., .1
  • : 29.03.1949 .., : , .
  • Man Migo-Brens: : www.vk.com/id220380782.
  • : 07.09.1945 .., :
  • : : 3510201195, 08.02.1996 .., - .., : ,
  • : 29.07.1977 .., : ., . -, 5
  • : 31.08.1943 .., : ""
  • Ͳ: : 3365604553, 23.02.1992 .., ʲ - .., : , ʲ
  • : : www.vk.com/id220801177.
  • : 15.10.1981 .. : . :
  • : 11.12.1992 .., .: HTC, : www.ok.ru+ , id : 73115105, : .
  • : 21.02.1965 .., : , .159, : 11.09.2008
  • Ը : : www.ok.ru+Ը , id : 73107806,
  • : 29.8.1964 .., : ( ), - .., : , : www.ok.ru+ , : , : 80-, id : 73585373,
  • : 14.09.1962 .., : , , /, , , 9
  • : 10.08.1955 - .., : .-, . . 52
  • : 13.05.1991 .., : , . .4 .4
  • : 23.10.1962 .., . , . .4
  • : TOYOTA CARINA, (), , , , 31425, 2001 .., : , :
  • : 08.03.1971 .., : , , , 47 : - " ".
  • : : 1669413117, 15.09.1945 .., в - .., : , ˲ֲ
  • : 15.8 .., : www.ok.ru+ , id : 27836157,
  • : 7.11 .., : www.ok.ru+ , id : 27727265, : http://vkontakte.ru/id27727265.
  • G: : www.ok.ru+ G, id : 73259858,
  • : 02.08.1966 .., : , 3- . .9
  • : 9.6 .., : www.ok.ru+ , id : 3177402,
  • : 13.09.91 .., : , , . , ., 14, 2
  • : 03.10.1954 .., : ., , . , , .18
  • : : www.ok.ru+ , id : 73304128,
  • : 04.08.1973 .., : ., , , .17
  • : 05.10.1973 .., : , , , 113
  • : : www.vk.com/id146695530.
  • : : www.ok.ru+ , id : 73287774,
  • : 12.11.1982 .., : ., , ., .11
  • : 01.11.1979 .., : 21124, , 31152, XTA21124070479668, 2007 .., : , . 7
  • : : www.ok.ru+ , id : 73242870,
  • : : www.ok.ru+ , id : 73177201,
  • : 14.10.1973 .., : , . . 219
  • : 14.05.1982 .., : -, .
  • : : , : , : , : , : www.ok.ru+ , : , : , id : 73779218, : ,
  • ò: : 3147212959, 02.03.1986 .., .ȯ - .., : , .ȯ
  • Earg Xcfb: : www.ok.ru+Earg Xcfb, id : 3153888,
  • : 22.3 .., - - .., : , : www.ok.ru+ , id : 73448257,
  • : 22.10.1934 .., : 665773, , - -, , , 6
  • : 13.6.1988 .., - .., : www.vk.com/id220096447.
  • : 17.2 .., : www.vk.com/id146859798.
  • : : www.vk.com/id146585586.
  • : 26.04.1997 .., : , .
  • : : www.vk.com/id221039053.
  • : 20.12.1958 .., : , 368663,-
  • Sdfsdf Sdfdsf: : www.ok.ru+Sdfsdf Sdfdsf, id : 73134514,
  • : 23.05.1984 .., : , , , 16.
  • : 04.12.1974 .., , . . 15, . (495) 3026669.
  • в ²: : 2484318590, 07.01.1968 .., в - .., : , в
  • : .: 8 9038252481, : . . 1
  • Csaba Jaro: : www.vk.com/id220521176.
  • : . .: 8 9065429305, : . . 6
  • : 29.8.1985 .., - .., .: 89276700195, : www.ok.ru+ , id : 73486299,
  • в ò: 27.10.1964 .., : , - 5940400000, . 2- ., 4, : , 2106, 9992Ѳ, 1982 .., : XTA210600C0682259.
  • : 11.03.1955 .., H ..H H -H - .., : (.: 17.05.2003 H H . H) 6, .
  • : 10.03.1932 .., : , , . 6 , 29.
  • : .: +79613636255, +73479165933, : 453731, , -, , .
  • Potapov Viktor: : www.vk.com/id220223298.
  • : MITSUBISHI PAJERO, (), , , , 81425, 1987 .., : , :
  • : : www.ok.ru+ , id : 73326206,
  • : : www.ok.ru+ , id : 73420504,
  • ò ˲: : 2201926559, 14.04.1960 .., Ͳ - .., : , Ͳ
  • : 14121959 .., : ., .39, : 21213, 86764, 1996 .., : XTA212130T1218271.
  • : 23.07.1997 .., : , 49 49.
  • : 15.03.1971 .., : , . .62
  • 4: 23.6 .., - .., .: 89613793***, : www.vk.com/id146685761.
  • : : 1780220650, 27.09.1948 .., ϲ - .., : , ϲ
  • : 18.03.2003 .., : . . : , 7.
  • Schurek Katerina: : www.vk.com/id220254734.
  • : 20.07.1958 .., : , , .
  • : 20.01.1957 ..
  • '': : , - 5941000000, 0, : AVIA, 21, 9540, 1989 .., : 0, 7596.
  • "--" - "--": , : 840000 ., ./: 186-79-98, 186-79-98, : - , : 7825692651, : 48959539, : , , , : 193036, 193036, 186-79-98.
  • : 23.11.1975 .., : , , -.
  • : 25.1.1992 .., : www.ok.ru+ , id : 27955645,
  • : 27.05.1961 .., : , - , , 65.
  • Afrwf Fdvgtg: : www.ok.ru+Afrwf Fdvgtg, id : 73608948,
  • : : www.vk.com/id146654693.
  • : , .48 . : : , : 27.12.1986, : 2, :
  • : : www.ok.ru+ , id : 3297617,
  • A: : ., 21063 ( ), - -, 1992 .., : , : 7854, 2275148, 2827079, :
  • : : www.vk.com/id220719441.
  • : 26.06.1941 .., : , . .97 .1
  • ²˲ ²: : 3026320018, 09.11.1982 .., ʲ - .., : , ʲ
  • : 10 .., : ., .30, : 32215, 107164, 2005 .., : X9632215060435808.
  • : 20.02.1932 .., : ., . -, 479 .
  • : 14.09.1948 .., : , . . 19, .: (495) 3231716
  • : Ammann Equipment Ltd, 5114, Warehouses Wholesalers, Plant & Machinery Dealers, : , , Bearley, Stratford-upon-Avon, Warwickshire, West Midlands, CV37 0TY, CV37 0TY, West Midlands, Warwickshire, Stratford-upon-Avon, .: 441789414525, jackienewby@ammann.co.uk, : Mr R Brown (Managing Director)
  • : 27.11 .., - .., : www.ok.ru+ , id : 73139570,
  • : 1.5 .., - .., : www.vk.com/id221187233.
  • : 4.4.1974 .., : www.vk.com/id220803144.
  • : - .., : www.ok.ru+ , id : 73114988, : , , :),
  • ²IJ ί βֲ : : , - 5940136600, 0, : , 21065, 0059̲, 1999 .., : XTA210650Y4203013.
  • : : , . , ., 11, .: 0/+380 (62) 527691.
  • : 25071955 .., - .., : - . . .27
  • : : ., . -, 12
  • : 19.11.1986 .., : , , , .
  • : 18.2.1989 .., : 21 : , google.(), : - . - , , . -!- ... . ( ), - .., : , : , , 23 , , 12 , - , 200 , , , : www.ok.ru+ , : ))), : , ..., id : 3282397, : - . . , . , , ,
  • , : : www.ok.ru+, , id : 73095117,
  • : : , 81,.3
  • : 01.01.1968 .., : ., , , 104.
  • "" ( ""): .: 29.04.2013 ., : 7723553031, : 1057748793519, : 770501001, : .2 .21.1 08.08.2001 129-, : 115093, , . , 44.
  • : 30.04.1955 .., : , . . 6, .: (495) 2801216
  • : : www.ok.ru+ , id : 3162602,
  • : 22.12.1983 .., : ., . -, 39
  • "" - "": , : 840000 ., ./: 122-60-41, 122-60-41, : - , : 0, : 50935836, : , , , : 190068, 190068, 122-60-41.
  • : : , . . 35, . (495) 1449455.
  • : 8.9.1996 .., : www.vk.com/id220675148.
  • : 1.8.1991 .., : www.ok.ru+ , id : 73279412,
  • : Delta Group Ltd: : Head Office, : Jeddah 21453 Ground & 1st Fl, Linjawi Center, Sharafiya King Khaled St, Ground & 1st Fl, Linjawi Center, Sharafiya King Khaled St 21453 Jeddah Saudi Arabia, : Osman A Linjawi - President, : 96626440141, deltacoating@hotmail.com, : Services.
  • : 11.5.1991 .., : www.ok.ru+ , id : 3158082,
  • : 13.12.1928 .., : , . .15 .3
  • Lazareva Olga: : I DON',T READ, READING SUX- 4 EVER, 4 LIFE!!!, : i got loads, but the main 1',s are:, parent trap, titanic, she',s da man, and, others....., : www.ok.ru+Lazareva Olga, : don',t have 1, only gay people do.... soz 2 da people dat have 1...lol..., : mmmmm.... lady gaga( the hottest chik ever), id : 28012788, : ok well i luv running, swimming- wat contains sport, then, eating, watching tv- wat contains life, and, going 2 skool- wat contains mii education!!!, : soz, no mii site.
  • Ѳ : : 3045325615, 18.05.1983 .., - .., : ,
  • : 22.08.1976 .., : , . . 22 . 2, .: (495) 3182596
  • : 13.3.1987 .., : www.ok.ru+ , id : 3288469,
  • Spina Francesco: 28.12.1995 .., : www.vk.com/id221071633.
  • : 12.07.1927 .., : ., . -, 8
  • : 15.02.1962 - .., : , , 348156, 2000 .., :
  • : : www.vk.com/id146496264.
  • : 12.05.1951 .., : , , , 3.
  • : : www.ok.ru+ , id : 73201949,
  • : : www.ok.ru+ , id : 3096208,
  • Hairstyling 2000: .: 332986456, : , , 3751BP, Bunschoten-Spakenburg, Sluisweg, 12.
  • : : www.vk.com/id220948031.
  • : 22.10.1968 .., : ., ., ., , .9
  • : 20.11 .., - .., : www.ok.ru+ , id : 73220336,
  • : : www.vk.com/id220516257.
  • : 3.3 .., : www.ok.ru+ , id : 73613551,
  • : 1.8.1920 .., : www.ok.ru+ , id : 3120437, : www.PokerStars.com.
  • : 20.10.1953 .., . - - ..
  • : 5.3.1991 .., : *=T+=-L*, : www.ok.ru+ , id : 73254906, : .
  • : TBZ CARDS DISTRIBUTION S.R.L.: : 1999 ., : Strada Traian nr.28, Code Postal:400046, Cluj - Napoca, Judetul CLUJ, Strada Traian nr.28, Code Postal:400046, Cluj - Napoca, Judetul CLUJ, : Mr. CRISTIAN CIUREANU - Manager, : 40264448828, : Import _i distribucie invitacii de nunt, puzzle, felicitri, rechizite _i manuale _colare., , , , , , , , , , : 6 : 2 mil. ROL : 163.000 EUR.
  • : , . 36 ,
  • Klein-Breteler Th J H: .: 703243874, : , , 2596CK, 's-Gravenhage, Wassenaarseweg, 76.
  • : 7.5 .., .: , : www.vk.com/id220075065.
  • : : www.ok.ru+ , id : 73827319,
  • : :
  • : Armley Squash Club, 9262, Sports, Leisure, Entertainment, Squash Courts, : , , Eyres Avenue, Leeds, West Yorkshire, Yorkshire & The Humber, LS12 3BA, LS12 3BA, Yorkshire & The Humber, West Yorkshire, Leeds, .: 441132633918, : Mrs Jackie Overend (Proprietor)
  • Gamer Toka: : www.vk.com/id220747741.
  • : 02.11.1959 .., : "", : .,
  • : : www.vk.com/id220073849.
  • : , . ,
  • : 13.7 .., : www.ok.ru+ , id : 73711315,
  • : - .., .: 89153578601, : surik3081@mail.ru, : www.vk.com/id146566654.
  • : : www.ok.ru+ , id : 73273513,
  • : 10.05.1937 .., : ., , , .18
  • ..: , . . ,
  • : 01.06.1943 .., : , . .6 .1
  • Mauray Chavvie: : www.vk.com/id220183386.
  • : 10.01.1948 .., : 443096, , , , , 62, : 322132, , , 68863 *, 32213230302903, 32210030016926, 33018009, 2003 ..
  • : 10.03.1979 .., : .,..
  • : - .., : www.vk.com/id220007308.
  • Minsk Karo: : www.ok.ru+Minsk Karo, id : 73848441,
  • ..: : ., , 87/22, .: 8 (8184) 12119.
  • : .: 89104913790 - Hertz HX 300 D 1200 6500. Alpine IVA-D105R 12500 . (, Hertz HX 300 D 1200, , : - , : 6500 .), : , .
  • : 22.12.1957 .., . , . .1 .2
  • : 01.10.1966 .., : ., . -, 4
  • Fox Hong: : www.ok.ru+Fox Hong, id : 73374654,
  • : : www.ok.ru+ , id : 3265887,
  • : 15.06.1940 .., : ,
  • : 03.09.1972 .., : ., , . , , .11
  • : 13.8.1997 .., .: , : , : www.vk.com/id220410522.
  • : 19.10.1979 .., : , ., ., 30. :
  • : : , . . 9 ,
  • : : www.vk.com/id220436075.
  • - : 21.10.1981 .., : www.vk.com/id220586250.
  • : 16.7 .., : www.ok.ru+ , id : 73686184, : .
  • : 30.7.1984 .., - .., : www.ok.ru+ , id : 73297042,
  • () : 27.11 .., : www.vk.com/id146903314.
  • : 26.5.1999 .., .: 89513247003, : www.vk.com/id220268378.
  • : :
  • : 01.01.1891 .., : , , 35.
  • Cesareo Martin-Sanz S. A. Transportes: : 28031, Madrid, .: +34 913.035.019
  • : 09.09.1959 - .., : , - , , , ., 2/1, : VOLKSWAGEN VW 1HXO, , L760HAM, WVWZZZ1HZPW592531, 1993 ..
  • : : , , 30%, : , , 30%, : , , 30%, : , , 30%, : www.ok.ru+ , : , , 30%, : , , 30%, id : 73181645, : , , 30%,
  • : - .., : , : , : www.ok.ru+ , : , : , id : 27849719, : , ,
  • : 15.11 .., : , : , , ., - .., : , : 11, 12, 13 , : www.ok.ru+ , : () )))))), : , id : 3137263, : , ,
  • Kemperman Dierenspeciaalzaak: : -, 6845CZ, Arnhem, Oostburgwal, 18, .: 263818595.
  • : 19.3.1964 .., Ƹ - .., : www.vk.com/id146602087.
  • : 1987 .., : , - , 15.
  • : 12.8.1999 .., : 1. , !!!!!!!, - .., : .-!, : ), : www.ok.ru+ , : !, id : 73249004,
  • Carballa Martinez Maria Isabel: : 28013, Madrid, .: +34 915.320.142
  • : 1.4.1993 .., .: 79221876489, : www.ok.ru+ , id : 73471612,
  • : 28.03.1976 .., . , . .10
  • : 12.10.1983 .., .: +7 342 2866454, : www.vk.com/id220359457.
  • : 8.4.1965 .., : www.vk.com/id220394698.
  • : 27.04.1971 ..
  • : 12.06.1949 .., . - - .., : , , 53.
  • : : www.ok.ru+ , id : 73353213,
  • ³ : 17.10.1982 .., : 96000, , , ., ., 13.
  • : 12.01.1939 .., . , . .64 .1
  • : - .., : www.ok.ru+ , id : 73659206,
  • ˸: 4.8 .., - .., .: 89140928805, : www.vk.com/id220161660.
  • : : www.vk.com/id220461198.
  • : .: 8 9084569305, : , , 10
  • : 27.06.1960 .., H . - .., : , , 5.
  • : : ., . -, 12
  • : : www.ok.ru+ , id : 73207173,
  • : 1950 .., : /. :
  • Marmeladka Oosmile: : www.vk.com/id220375561.
  • : 13.05.1954 .., : , . .10 .1
  • : 17.02.1941 .., : , .108
  • Striencu Daniel: 10.10.1999 .., Coteni mahala - .., : www.vk.com/id221010632.
  • : : www.vk.com/id220400007.
  • - : 14.02.1968 .., : , 2
  • Sdfsdfsdfs Fvfdgsdfsdf: : www.ok.ru+Sdfsdfsdfs Fvfdgsdfsdf, id : 73488047,
  • : : . 2 -, 6, : NISSAN PRIMERA 1998 ., 1597 ., VIN-SJNTAAP11U0249165, 77054516.
  • : .: 9602887563, : www.ok.ru+ , id : 73074905,
  • : 20.04.1997 .., : , . .17 .1
  • : 29.5 .., .: apple, : www.vk.com/id146725571.
  • WONG DESPAIGNE MARIA E: .: 8786950, : , PE ALVER 654 PISO 1HABANA
  • : 25.02.1950 .., , . . 11 . 3, . (495) 1745688.
  • : 25.09.1979 .., : 98222, , , -, ., ., 5.
  • : : www.vk.com/id221149212.
  • Surrender Ilia: 24.4.1987 .., Vologda - .., : www.vk.com/id146570398.
  • : 04.02.1957 .., : , ., 66. : "" , : , 102, .: 255969
  • : : ., 163061, , , 164, .: 8 (8182) 640522.
  • : 01.01.1946 .., : . - .11
  • : 07.04.1966 .., : , 149
  • : 1.1.1991 .., Sin City - .., : pawel_world1, : www.vk.com/id146905267.
  • : 26.12 .., : , ...... , , ........, : - ))))))), - .., : www.ok.ru+ , id : 73563493,
  • Ruletka2 Ruletka2: sfd - .., : www.ok.ru+Ruletka2 Ruletka2, id : 73763485,
  • : 20.3 .., - .., : www.vk.com/id220117457.
  • ܪ : : 3300908995, 17.05.1990 .., ʲ - .., : , ʲ
  • : : www.vk.com/id221125313.
  • Juffer W J: .: 365226904, : , , 3892VG, Zeewolde, Hermelijnhof, 6.
  • : 15.05.1923 .., : , . .28 .1
  • : 18.12.1962 .., : ., . , . 17
  • : 4.1.1983 .., : www.vk.com/id146691567.
  • : 16.2.1991 .., : www.vk.com/id220135320.
  • : : - . 38, .: 8 (383) 3543036.
  • : 17.02.1987 .., : ., , , 11.
  • : 21.2 .., : www.ok.ru+ , id : 27754053,
  • : : www.ok.ru+ , id : 73528893,
  • : The Skannda Vale, 8514, Hospitals & Medical Establishments, Hospices, : , , Saron, Gwastod, Llandysul, Dyfed, Wales, SA44 5DY, SA44 5DY, Wales, Dyfed, Llandysul, .: 441559371222, www.skanndavale.org, A.Jacob@skanndavale.org, : Mr A Jacob (Manager)
  • : .: 8 9146684194, : , ,-, 37
  • : : ., .103
  • : : www.vk.com/id220640744.
  • Jongh S: .: 355231284, : , , 1271LS, Huizen, Eemnesserweg, 5.
  • Abarai Renji: : www.ok.ru+Abarai Renji, id : 73392019,
  • () ***: : www.ok.ru+() ***, id : 73865303,
  • : 18.1 .., : www.vk.com/id220366533.
  • : 01.01.1961 .., : , . .93/1
  • : 19.12.1924 .., : , , 15
  • : 16.8.1987 .., : www.ok.ru+ , id : 27920999,
  • Mendis B S: : -, MF, 60/17D Francisco Pl Moratuwa
  • : 05.11.1926 .., : , , , 98.
  • : : www.ok.ru+ , id : 28004455,
  • : 10.01.1986 .., :
  • Ͳ Ͳ: : 2766020870, 24.09.1975 .., - .., : ,
  • : 14.6.1996 .., : www.vk.com/id220948223.
  • : : www.vk.com/id220504549.
  • : . , . 1
  • : 22.01.1916 .., : ., . -, 6
  • : 10.12.1986 ..
  • : 2.12 .., : www.vk.com/id221026300.
  • : : www.ok.ru+ , id : 73319368,
  • : : 3166414491, 10.09.1986 .., Ͳ - .., : , ²
  • - (-): .: 16.08.2006 ., : 5067746160345, : .2 .21.1 08.08.2001 129-, : 115522, .
  • Yurov Sasha: : www.ok.ru+Yurov Sasha, id : 3289243,
  • : .: 89129753689, : www.vk.com/id220733689.
  • : 8.5.1982 .., : www.ok.ru+ , id : 3194065, : -.
  • : .: 89065863547 (), : ., 396650, . , . , .30
  • : 18.08.1972 .., : ., , . , 3 , .5
  • : 02.06.1978 .., : , . .3
  • "" - "": , : 840000 ., ./: 973-17-08, : - , : 0, : 47977311, : , : 197348, 000000.
  • : : : 1910 ., : 211720 , , , ., 18, 211720 , , , ., 18, : - , : 375215721271, : , , , : 6.
  • : 24.05.1960 .., : , --, -, ., 10. : "" , : , , 38/2, : , .: 554615.
  • : 18.07.1993 .., : ., , . , . , .39
  • : 19.12.1982 .., : , , , 34 : - " - ".
  • : 01011947 .., - .., : - . . .2
  • 12.07.1964 ..: : ., . .64
  • : 2.3.1984 .., : www.ok.ru+ , id : 3093654,
  • : - .., : www.vk.com/id221008358.
  • : 18.07.1965 .., . (495) 2198031.
  • : - .., : www.vk.com/id220585245.
  • : 08.02.1966 .., , . . 15 . 2, . (495) 3478083.
  • Sdasadsad Sadsad: : www.ok.ru+Sdasadsad Sadsad, id : 73511704,
  • : .: 8 9502827746, : , , 17
  • Das Das: : www.ok.ru+Das Das, id : 73296040,
  • : 22.08.1945 .., : , . .15 .2
  • : : 3017025072, 08.08.1982 .., ղ - .., : , ղ
  • : 11.11.1911 .., : , - 5640100000, , 24, : AUDI, 100, 7350, 1984 .., : WAVZZZ44ZEN108586.
  • 06.12.1958 ..: : ., . . .1
  • : 29.04.1929 .., : , ., 115-.
  • : 01101984 .., : ., .40, : BMW 528I, 78764, 1996 .., : WBADD61060BR20384.
  • : 25.2 .., : No Pain - No Gain, : , - .., .: +79296365255, : powerlfer, : www.ok.ru+ , : h1deki, id : 3264337,
  • : : www.vk.com/id146574459.
  • : Construcciones Metlicas, S.L.: : Head Office, : ES 50057 - Pol. Indl. Malpica Calle L, 189 Zaragoza, Calle L, 189 - Pol. Indl. Malpica ES 50057 Zaragoza Spain, : Jess Monge Claver - Chairman, : 34976571804, : Manufacturers : Between 11 and 20.
  • : 24.9.1962 .., - .., : www.vk.com/id220229075.
  • : 25.08.1959 .., : , , , 81.
  • : : www.vk.com/id221106150.
  • : 06.02.1979 .., : ,
  • : 16.06.1991 .., : , , 50 , 206
  • : 20.06.1967 .., : , , , 19
  • : 30.03.1964 .., : , , ., 16/5, : , 170177, 2004 .., : JMZCZ94145KM17897.
  • : 03.08.1962 .., : , ., 24
  • : 21.07.1928 .., : , . .36 .1
  • Makana Peehole: : www.vk.com/id220388078.
  • : : www.vk.com/id220379381.
  • : .: 8 (8312) 237447, : . , , 15
  • : 11/18/37 .., : ., . , -, 73
  • : 22.05.1980 .., : , , 13- 41
  • : 03.08.1938 .., : ., , , .11
  • : 06.08.1926 .., . - ..
  • Melek Ms: 8.5 .., : www.vk.com/id220128495.
  • : 3.12.1970 .., - .., : www.vk.com/id220735203.
  • : 01.07.1956 .., , . . 10 . 2, . (495) 1257910.
  • : 23.5 .., : www.vk.com/id221077823.
  • : 01.01.1900 .., : , - 5940400000, ., 13, : CIZETA, 350, 4462, 1979 .., : 0, 4724041120.
  • : 17.11 .., - .., : www.ok.ru+ , id : 27986878,
  • : 01.01.1947 .., . ,
  • : 21.8.1989 .., , -- - .., : www.vk.com/id220749830.
  • : 13.11.1960 ..
  • , , : 2101, 3949060, 7076, 1981 ..
  • : 09.07.1962 .., : ., . -, 10
  • : 20.7.1988 .., : www.vk.com/id220011151.
  • : 26.09.1949 .., : , , , 139
  • : : www.ok.ru+ , id : 73580379,
  • : 13.1.1989 .., : , ()- ()- (). - .., .: 8-963-290-84-76, : , , !, : www.ok.ru+ , : Dj ALLIGATOR, SCOOTER, , ferry_corsten, SKILET!, id : 73441955, : , , , !, : .
  • Sahtaxtinski Mamed: 19.7 .., : www.vk.com/id220899736.
  • : 01.01.1992 .., : , . .2
  • : : www.ok.ru+ , id : 73537106,
  • : 2140, (), , , , 5040, 1987 .., : , :
  • : 16.03.1947 .., : ., . -, 25
  • : 03.12.1990 .
  • : 04.06.1984 .., : , .
  • : 01.01.1967 .., : ., -
  • : 18.02.1921 .., : , ., .5,
  • : : www.vk.com/id220309330.
  • : ²²Ͳ "" ( ""), : , 42700 , , . , .3 , .: , 42700 , , . , .7, .: ̲ ί ̲ί , 16301020000000030, 05.10.2004 ., : 1) 2142025784, Ͳ IJ , . 33340 2) 2267011938, в , . 33340 3) 3008116738, Ͳ , . 23340, : : : , ..: 42112 ..: 42112.
  • : 10.1 .., : - , , , , : , , , GTA, - .., .: samsung3600i, : , , , , : www.ok.ru+ , : , , 95 , , : , id : 73234946, : , , , , .., : http://vkontakte.ru/id73234946.
  • : 10.9.1993 .., : www.vk.com/id220801190.
  • : : www.vk.com/id220363825.
  • : 18.06.1992 .., : , -
  • : 01.11.1977 .., : , . .5
  • Xxxxx Mafia: : Parfumer, : www.ok.ru+Xxxxx Mafia, id : 73753307,
  • : 9.7.1994 .., - .., : www.ok.ru+ , id : 73326050,
  • : 08.02.1918 .., H -H .H - .., : (.: 29.10.79 H. ) 4/7, .
  • "" ., -: .., : 14, 0, : 133, , 4705, , 1976 ..
  • : 09.02.1938 .., : 968, 91702, , 1990 .., : 1482781, 030341, .: 28988, : , , , 16.
  • Ѫ I: .: 80975029435, 80975029435, +380975029435, : , -, . , .92,
  • : : www.ok.ru+ , id : 73163306,
  • : ILT Pltprodukter AB: : Head Office, : 1989 ., : SE 77222 Skrssbcksv 13 Grngesberg, Skrssbcksv 13 SE 77222 Grngesberg Sweden, : Ingmar Granlycke - Managing Director, : 4624022189, info@iltprodukter.se, : Manufacturers : 5 : 653317 EUR : 100000 (SEK).
  • : 26.5.1956 .., : www.vk.com/id220721400.
  • : : ., , , .: 8 (3519) 323072
  • Shevchenko Maxim: 6.6.1986 .., : www.ok.ru+Shevchenko Maxim, id : 27816802, : !).
  • _: : a_terpinov@mail.ru
  • SUZHOU City Suburb GUSU Dark reddish brown Factory: : LUO,GENFA, : dark reddish brown , starch syrup, : , 215151, Jiangsu, Suzhou, SANZU, LIANXIANG Village, HUSHUGUAN Town.
  • : 17.04.1964 .., : , , , 16
  • Ͳ : : 3176811776, 23.12.1986 .., Ѳ - .., : ,
  • : 09.12.1978 .., : 443112, , ., : 21060, , -, 09163 *, 7D21060010052214, 21065014318989, 6547375, 2000 ..
  • Igrok Igrok1: : www.ok.ru+Igrok Igrok1, id : 73261104,
  • ',: 28.1 .., . - .., .: 0961693848, : --------------, : www.vk.com/id146783871.
  • : 28.10.1936 .., : , , .
  • : 28.04.1935 .., : , . . .3 .3
  • Mukanova Karina: : www.vk.com/id220015164.
  • : 14.08.1947 .., : , . .24
  • : 01.06.1955 .., . , . .12
  • Vittall Bella: 1.1.1995 .., .: 02, : www.vk.com/id220446142.
  • "" ( ""): .: 11.02.2010 ., : 6317042233, : 1106317000778, : 631701001, : .2 .21.1 08.08.2001 129-, : 443099, , .
  • : .: 8 (921) 6020031, : , 9
  • : : www.ok.ru+ , id : 73342842,
  • : 19.02.1927 .., : , 2- . . 27, .: (495) 2165444
  • : : www.vk.com/id220848731.
  • : : , . , ., 45, .: 0/+380 (62) 3052407.
  • : 29.09.1963 .., , . . 5, . (495) 4773977.
  • : : www.vk.com/id221154864.
  • : : www.vk.com/id146507555.
  • : : 1778529019, 10.09.1948 .., ղ - .., : ,
  • : .: 8 (921) 9462953, 4373087, 4373087, : -, 23
  • ( .): 15.02.1945 ..
  • : : 2013322613, 14.02.1955 .., Ͳ - .., : ,
  • : : , 14
  • : : www.vk.com/id220131747.
  • Fereo Medispa: 1.10 .., - .., .: 37-22-92, : medispafereo, : www.vk.com/id220466645.
  • : : www.ok.ru+ , id : 73275248,
  • : 28.07.1946 .., : , . .18 .5
  • : : www.vk.com/id220978031.
  • 01.06.1977 ..: : ., . -3 .20
  • : 13031985 .., - .., : - . ..
  • : 01.05.1973 .., : , , ., 11
  • : : www.vk.com/id220469868.
  • : 22.7.1998 .., - .., .: 89607895292, : www.ok.ru+ , id : 73344077,
  • : : ., .5
  • ? : : www.ok.ru+? , id : 28043570,
  • : 5.2 .., - .., : www.vk.com/id221172406.
  • : 27.09.2000 .., : , . . 3, .: (495) 2865095
  • ..: : , . 2 6
  • : 16.06.1985 .., : , . 367-21.
  • : 1.3.1995 .., : www.ok.ru+ , id : 73242821,
  • : : www.vk.com/id146927054.
  • : .: +79065632345, +74923331852, : 601440, , -, ,
  • 19.05.1982 ..: : ., . .39
  • : : !!!, - .., : , , ׸ , : - , , ( ) , , . . (:, : www.ok.ru+ , : , MTB, : , , ARB (:!!!, id : 73089293, : ! , - . .,
  • : : www.ok.ru+ , id : 73521875,
  • : 16.09.1938 .., : , , ( -).
  • : : , : , : , : , : www.ok.ru+ , : , : , id : 73851008, : ,
  • : 01.02.1938 .., -H H - .., : , , 20.
  • : .: 8 9065427422, : . . 54607
  • : 26.10.1938 .., . , . .23 .2
  • Llll : 4.10 .., : www.vk.com/id146785691.
  • : : www.ok.ru+ , id : 28002602,
  • : 28.3 .., : www.ok.ru+ , id : 3271260,
  • : 15.06.1986 .., : , 13
  • : : www.vk.com/id220433237.
  • : 1.9 .., - .., .: 8951608866*, : www.ok.ru+ , id : 73341448, : ???__.
  • : 01.01.1972 .., : , . .5 .1
  • : 31.10.1971 .., : , . . 12, .: (495) 2916147
  • : 04.02.1958 .., : , , , 76.
  • Ъ в : : 3172810915, 13.11.1986 .., вղ - .., : , вղ
  • : : ...., : , - .., : , .: 8961660370*, : , : www.ok.ru+ , : ...., : , id : 73827929, : , ),
  • Yo Yo: 17.5.1995 .., : www.vk.com/id220859877.
  • : - .., : www.vk.com/id220573378.
  • : : , , 21, .: (8) 9109713216.
  • : 04.10.2003 .., : , --, -, ., 78.
  • : 30.10.1990 .., : ., , . , , .45
  • 10.07.1961 ..: : ., . .84/86
  • Disco-Karaoke-Club Keruen: - .., : www.vk.com/id220647222.
  • : 1.7 .., : www.ok.ru+ , id : 3215555,
  • : 1978 .., : 15. :
  • : 31.08.1975 .., : , .
  • : : www.ok.ru+ , id : 73839121,
  • : 09.10.1952 .., : . , : - "" 7708503727, : , .
  • ĸ : : www.vk.com/id221043767.
  • : 18.12.2006 .., H H - .., : , , 4.
  • : .: 89031726999 - 2- (25 ) 700 . . , , , , , , , . , , . (, (), , , , : 1000 .), :
  • : 13.10.1943 .., : ., .2
  • : - - . - - .., : , - - . - .,
  • Lizi Elizabeth: 13.4.1985 .., : www.ok.ru+Lizi Elizabeth, id : 3216342,
  • : 10.01.1964 .., : - , : ., .67
  • : : www.ok.ru+ , id : 73363002,
  • : 27.10.1982 .., .: 89378383599, : www.vk.com/id221096371.
  • Scorpiantonw Scorpiantonw: : www.ok.ru+Scorpiantonw Scorpiantonw, id : 73210314,
  • : 02.09.1962 .., : , : " " 5258000029, : , .
  • : 04.06.1947 .., : , . . 23 . 2, .: (495) 9794520
  • : : , : 3, - .., : , .: 89028991250, : www.ok.ru+ , : , : , id : 73577424, : ,
  • , : , . , 50- .
  • : : www.vk.com/id146567853.
  • : 09.08.1961 .., : , . .8 .1
  • : 21.10.1950 .., , . . 11 . 2, . (495) 4471723.
  • : 24.01.1961 .., : , . . 18, .: (495) 4998511
  • : 16.12.1921 .., : , . . 22, .: (495) 3026281
  • : : , , 03.05.1968 .. . 49
  • : 12071958 .., : ., .74.1, : 11113022, 648477, 2005 .., : XTC11113050312910.
  • : : www.ok.ru+ , id : 73143300,
  • : 05.11.1997 .., : --,
  • Sinecura Sinecura: : www.ok.ru+Sinecura Sinecura, id : 73786476,
  • : 23.02.1924 .., : , . .29 .4
  • : 26.08.1983 .., : " "
  • Harutyunyan Davit: : www.vk.com/id220450467.
  • : 14.10.1978 .., : , .
  • : 21.11.1972 .., : , , . : -, : 10.
  • Areshkina Natasha: 27.12.1992 .., : www.ok.ru+Areshkina Natasha, id : 73465382,
  • : : www.vk.com/id146940162.
  • : .: , : www.ok.ru+ , id : 73562581,
  • : 24.12.1956 .., : , .
  • : : www.vk.com/id220076761.
  • : : www.ok.ru+ , id : 73686015,
  • : 3.12 .., : www.ok.ru+ , id : 73127876,
  • : 17.3 .., : , , : , , - .., : , : , : www.ok.ru+ , : -------------, : =), id : 3224089, : , , , , , , , , , , -, , , , , , , . =), : http://twitter.com/Ler4on0k.
  • : , . . 32 . 6 ,
  • Li Naruto: Tokyo - .., .: 89162136220, : ?????????????? ???????????????????????????? ???????????????????????? ?6???????????????????? ?????????????????????????????????????????????????????????? ?????????????????1????????????????????????, : ninjadobrov, : www.ok.ru+Li Naruto, id : 73463149, : ??????????????????????????????????????????????????????????????????????????????????????????? ? ??????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????? ? ???????????????????????????????????????????????????????? ? ??????????????????????????????????????????????????????????????????????????????????????????????10m????????????? ? ???????????????????????5??????????????????????????????????????????????????????????????????????????????????????????????, : http://ninjajapan.ru.
  • : 1975 .., : . , , , 54.
  • : 21.1 .., - .., .: 89887042773, : , : www.vk.com/id220204009.
  • : 22.5.1987 .., : www.ok.ru+ , id : 3256929,
  • : 10.6 .., : www.vk.com/id220404546.
  • : : www.vk.com/id221056025.
  • : 30.1.1977 .., - .., : www.vk.com/id146601721.
  • : 25.05.1937 .., : . - - . . .3 . .
  • .. . 18 22 (2000.02.01 ): .: 8 (473) 26428026
  • : : www.ok.ru+ , id : 73434421,
  • : 20.4 .., : www.ok.ru+ , id : 73456769,
  • : 02.02.1955 .., . , .109 .2
  • Macho Macho: : www.vk.com/id220507188.
  • : 19.10.1962 .., : , , . , , .30,
  • : 16.08.1970 .., : , : "-" 5250043567, : , .
  • : 17.06.1955 .., , . . 24, . (495) 4469816.
  • Rgrgdr Ggrgr: : www.ok.ru+Rgrgdr Ggrgr, id : 73593468,
  • ²: : 3006322914, 23.04.1982 .., - .., : ,
  • WUXI City NANCHANG District RONGFA Small-sized general merchandise Store: : JIANG,RONGRONG, : general merchandises, : , 214011, Jiangsu, Wuxi, 1#, No. 90, QINGYANG Road, .: (510) 5024484.
  • ʲ : : 3063721093, 18.11.1983 .., - .., : ,
  • : 24.08.1956 .., : , - 5640700000, II, 20/1., : FORD, SIERRA, 46467, 1983 .., : WFOAXXGBBADJ59796.
  • : 24.11.1985 .., C - .., : www.ok.ru+ , id : 27894364,
  • : .: ***********, : www.ok.ru+ , id : 73821453,
  • : : www.vk.com/id146552476.
  • : : 330230, 96102, -, 40260P, 2000 .., : 330230Y1798277, 1814282, 0009588, 0126134, : , .
  • : 05.07.1938 .., : . , .., 21. : . " " . - - ...... , : -17, .: 432359
  • : 01.01.1960 .., :
  • : : www.vk.com/id221088360.
  • Dsfsd Fdsf: : gf, : gd, gfdfg - .., : gd, : fgd, : www.ok.ru+Dsfsd Fdsf, : fgd, : gfd, id : 73754924, : gfd,
  • : : www.vk.com/id220203642.
  • : 14.04.1984 .., : , .
  • : 01.01.1900 .., : , - 5921586400, ., ., : , 2140, 9605, 1983 .., : 1334190, 070976.
  • : : www.vk.com/id221016892.
  • : :
  • : 27.12.1913 .., : , , - -.
  • : 16.07.1936 .., : , . . 16, .: (495) 3024795
  • : : 775603036, 27.03.1921 .., ײ - .., : , ˲
  • : 24.05.1983 .., : ., , . , 1
  • : : www.ok.ru+ , id : 27972727,
  • : 14.9 .., : www.ok.ru+ , id : 73125843,
  • : 6.5 .., : www.ok.ru+ , id : 73586856,
  • Cool Karina: : [], : www.ok.ru+Cool Karina, id : 73260872,
  • : 17.07.1946 .., : , - , , 11. : 3 .
  • : 6.3.1998 .., -, - .., .: 89115661942, : vlad.arishtovih.98, : www.vk.com/id220523402.
  • : : www.ok.ru+ , id : 27901241,
  • : 22.06.1979 .., : ., , , 152 3
  • H H ( .): 22.12.1955 .., : - .
  • : 19.09.1981 .., , . . 74, . (495) 9306622.
  • : 28.11 .., - .., .: 89045145056, : www.vk.com/id221170556.
  • : 01.02.35 .., : , , ., 14
  • : : www.ok.ru+ , id : 27816719,
  • : 15.05.1962 .., : , -, , 27
  • : : www.ok.ru+ , id : 3065924,
  • : 23.7.1998 .., : , - .., : 2, : , : www.ok.ru+ , : -, id : 73714638, : ,
  • : : www.ok.ru+ , id : 73813889,
  • : : www.ok.ru+ , id : 28044442,
  • Ask Malika: 28.6 .., : www.vk.com/id220833053.
  • : : www.ok.ru+ , id : 73397314,
  • : 15.01.1957 .., : 2101, 27802, , 1973 .., : 0290657, 0288617, .: 39145, : , , , 39.
  • : : www.vk.com/id220750099.
  • : - "". : , -, - , , 303. : 4-43-55, 4-43-55. : 910000 .
  • : : www.vk.com/id220238135.
  • ² : : 3198112054, 24.07.1987 .., ʲ - .., : , ʲ
  • : 08.10.2003 .., : , , , .17
  • : : www.vk.com/id146931334.
  • - 70 10: .: 8 (343) 703867
  • : : www.vk.com/id220258811.
  • : 11.08.1972 .., : , . .62
  • : - .., .: 8904191XxXx, : , : www.vk.com/id146837499.
  • ò: 02.01.1972 .., : , - 5624684901, 1 , 31, : MAZDA, 626, 70743, 2002 .., : JMZGF14R201450101.
  • Korsak Ruslan: : www.ok.ru+Korsak Ruslan, id : 73159283,
  • : 2.6 .., : www.vk.com/id220763712.
  • : 21.11.1987 .., : www.ok.ru+ , id : 27808838, : .
  • : 12.7.1988 .., -city-Moscow - .., : www.ok.ru+ , : R',n',B, Club, id : 27924611, : , , ZZZ...., : .....
  • Maks~xxx~: 10.4.1984 .., - .., : www.ok.ru+ Maks~xxx~, : Rap., id : 73538279, : , . , .,
  • : : ., . -, 15
  • : : www.vk.com/id220585862.
  • : 18.09.1966 ..
  • Box Nursik: 17.7 .., : www.vk.com/id220724303.
  • Hye Kjhvg: : www.ok.ru+Hye Kjhvg, id : 73803563,
  • : 29.8.1971 .., - .., : www.vk.com/id146705056.
  • : : www.ok.ru+ , id : 28043773,
  • : : www.vk.com/id221196237.
  • : : www.vk.com/id220996501.
  • Kill Mahcete: : www.vk.com/id220264253.
  • : 14.2 .., : www.ok.ru+ , id : 73447486,
  • : 11.02.1958 - .., : , - , -, -, , 111, : AUDI 100, , N494EMM, WAUZZZ44ZHN10866, 1987 ..
  • ? ?: : www.vk.com/id220364488.
  • : 12.9 .., : www.vk.com/id220203627.
  • Asechka Asechka: : www.vk.com/id220487828.
  • : 8.1 .., .: 89631358229, : ulmasjon.otajonov, : www.vk.com/id220033673.
  • : 27.07.1936 .., : 968, 50602, -, 1972 .., : 024054, 282984, 107523, : , , , 3.
  • : : www.vk.com/id220118597.
  • : 13.5.1989 .., : , : , - .., : , : , : www.ok.ru+ , : , , : , id : 3134313, : , ,
  • : 07.08.1975 .., : , . .190
  • : : 2632021954, 23.01.1972 .., вֲ - .., : , IJ
  • : 02.03.1981 .., : , 3
  • : 18.5 .., .: 89208373520, : ykrop20004, : www.vk.com/id220217182.
  • ²˲: 03.11.1981 .., : , - 5940136600, , 26, : , 110307, 63609, 2003 .., : Y6D11030730031578.
  • - (): .: 8 9146861832, : , . , 25-27 2
  • Malenkij Angel: : www.vk.com/id220864743.
  • : 01.01.1977 .., : , . .14
  • : 27.04.1965 .., - . - - .., : .,.,60.
  • : 6.12.1988 .., : Sunny, : www.ok.ru+ , id : 3271098,
  • : 15.2 .., : www.ok.ru+ , id : 27849769,
  • в : : 1461935319, 10.01.1940 .., - .., : , Ͳ
  • : 26.06.1980 .., : .
  • : 11011986 .., : ., ..3731, : 217230, 17164, 2010 .., : XTA217230A0099698.
  • : 23.01.1921 .., : , . . 6, .: (495) 2547764
  • : 19.02.1951 .., : ., . -, 14
  • : 13.08.1964 .., : , , , 30 : "".
  • 21.01.1963 ..: : ., .
  • : : , . .4.
  • : 16.11.1981 ..
  • : 07.09.1979 .., : ., . -, 31
  • : 16.03.1954 .., : . -, -, ., 5
  • : 23.10.1998 .., : sergei34622, : www.vk.com/id220459714.
  • ˪Ѫ : : 2386520018, 04.05.1965 .., в - .., : , в
  • : : 2096221019, 23.05.1957 .., Ͳ - .., : , Ͳ
  • ..: : . , 9, .: 8 (3522) 53-91-73
  • Sherov Ahmad: .: 9261512505, : ahmedgon84, : www.vk.com/id220002520.
  • : 19.02.1942 .., : , .26 .12
  • : 23.10.1976 .., : . -, -, ., 49, .: (812) 5890629.
  • : 1999 .., . - - ..
  • : : ., .3
  • : 22.1.1988 .., : www.ok.ru+ , id : 27957702,
  • : 19.11 .., : www.ok.ru+ , id : 27800617,
  • : 28.08.1931 .., : ., -
  • : HONDA DOMANI, (), , , , 55825, 1994 .., : , :
  • : 01.03.1945 .., : , , ., -, ., ., 27, : 350, , 9238, 162740, 162740, 245230, 1900 ..
  • : : www.ok.ru+ , id : 73208246,
  • : 21.09.1925 .., : , . .835
  • : : www.ok.ru+ , id : 73442835,
  • & Wash&Go!: .: +7 (495) 789-58-47, : , . , 14, @-www: www.washago.ru, : , , , , ,
  • : .: 8-921-0608511 (), : ., . - -. . , 12
  • ²: : 3092320593, 30.08.1984 .., ײ - .., : , ײ
  • : 30.6.1996 .., NOVOSIBIRSK - .., : www.ok.ru+ , id : 73500904,
  • .. . 141 161 (2000.02.01 ): .: 8 (473) 746558
  • : .: 89144913106 (), : . (.), , -. . 48
  • : : www.ok.ru+ , id : 3285150,
  • : : www.ok.ru+ , id : 73243786,
  • : .: +79184145733, +78612276308, : , 350029, , , 1 , 118
  • : - .., : www.ok.ru+ , id : 3228161,
  • : 24.06.1975 .., . , .48
  • : 13.09.1937 .., : , . .1552
  • : 01.09.1961 ..
  • : .: 8 9066747693, : . . 38- 23
  • : 15.7.1988 .., : www.vk.com/id220821502.
  • : 16.4.1974 .., .: , : , : www.vk.com/id220516176.
  • : , . . 846 . . 846 . . 846 . . 846 . . 846, . (495) 5316667.
  • : , - . . 25 ,
  • : 11.04.1994 .., : , , , 19. : , : 2.
  • : c. - .., : www.ok.ru+ , id : 73228904,
  • Dastan Furkan: : www.vk.com/id220348497.
  • : 24.09.1926 .., : , , , 2
  • Draw Corel: : www.ok.ru+Draw Corel, id : 73728297,
  • : 05.06.1937 .., : . -, -, -, 84, .: (812) 3777510.
  • : : www.vk.com/id220697128.
  • : : www.vk.com/id146643623.
  • "" - "": , : 840000 ., ./: 327-36-57, : - , : 7825403194, : 48019345, : , : 193036, 000000.
  • : 18.06.1985 .., : , .
  • : 09.06.1984 .., : , -- --, , 96/1. : " "
  • : 24.12.1963 .., . - ..
  • Fio Nani: : www.vk.com/id220816681.
  • : 28.09.1931 .., . , . .8
  • : : , : warkraft, - .., : warkraft, : , : www.ok.ru+ , : , : , id : 73105375, : ,
  • : 06041953 .., - .., : . -. . .8
  • - : 14.8.1987 .., - .., : www.vk.com/id220510432.
  • : 08.04.1991 .., : ., , . , , .1
  • : 23.10.1987 .., - .., : www.vk.com/id220419657.
  • : 16.6.1982 .., - .., : www.vk.com/id146748587.
  • : : www.ok.ru+ , id : 73577020,
  • : : www.ok.ru+ , id : 73394121,
  • : 15.10.1985 .., - .., .: , , : www.vk.com/id220373366.
  • : 12.07.1911 .., .: (495) 1323079
  • : .: 89104088875 - , /, , .. . (, Ford Galaxy, , : > , : 5000 .), : , . -
  • : 13.06.1969 .., : , . .11
  • : 31.1.1998 .., : , - .., : , : , : www.ok.ru+ , : , id : 73143103,
  • : 11.11.1971 .., : www.vk.com/id220095832.
  • : 01.10.1948 .., : ., --, , 12/1.
  • -: 11.07.1998 .., . , . 2
  • : 20021958 .., : ., - .131, : 8350, 980664, 1986 ..,
  • : : , : v.korobov2013@mail.ru
  • : 21.09.1921 .., , . . 15/10, . (495) 4213635.
  • : : www.vk.com/id220736206.
  • : 14.08.1960 .., : 21065, 74202, , 1997 .., : 210650W3939176, 3939176, 4968572, : , , , 17.
  • : 05.05.1981 .., : ., .17
  • : 8.3.1979 .., -- - .., : www.vk.com/id146507294.
  • : 11.07.1987 .., :
  • : 01.11.1931 .., . , . .39
  • : : www.ok.ru+ , id : 73548386,
  • *****z***** Edik: : BLJARD CHACHKI, : AVTONERI MASIN SIRO MASIN ES SIRUMEM GARE LAV GRQER KARDAM, : AMERIKAKAN RUSSAKAN MAFYA EV LAV KINONER, : www.ok.ru+*****z***** Edik, : RUBIKON TOP10 Yere1, : INCH DUREN GALIS GARE ERASHTUTYUN, id : 73171069,
  • : 29.10.1981 .., : 652070, , -, , ., . 9
  • в ²: : 2801520430, 13.09.1976 .., ² - .., : , ²
  • : 15.3 .., : , ( ) - .., : www.ok.ru+ , id : 27984541,
  • : 20.10.1938 .., : , . .21 .1
  • Vladimirovich Anatoliy: : www.vk.com/id220167151.
  • : 04.04.1942 .., H HH H - .., : (.: 10.07.2002 H-H H . H) 31, .
  • в : : 3083323077, 01.06.1984 .., - .., : ,
  • : 14.3.1986 .., : .., - .., : , : , : www.ok.ru+ , : , : , id : 73072812,
  • : 1.6 .., : www.ok.ru+ , id : 27798891,
  • : 25.9 .., : www.vk.com/id220005072.
  • : : , , , , : 21213, -, P158BD, 21213041740565, 2003 ..
  • : .: 8 9036586115, : . . 15
  • Kartinka Dimka: : www.ok.ru+Kartinka Dimka, id : 73339204,
  • : : www.vk.com/id146672660.
  • : 29.03.1933 - .., : .-, . . 41
  • : : www.ok.ru+ , id : 73820137,
  • : : , : , : . , : My blueberry nights, : www.ok.ru+ , : , : , id : 27718623, : , ,
  • Lewa Makc-maksim-27: 27.7.1986 .., : , : , - .., : , : , : www.ok.ru+Lewa Makc-maksim-27, : , : , id : 73801865, : , : .
  • : 11.10.1937 .., : , , , 83
  • : : www.vk.com/id220118097.
  • : 2.9.1991 .., : www.vk.com/id146645875.
  • : 01.01.1965 .., : ., , , 8.
  • : 09.11.1917 .., : , - N 30, 52.
  • : : www.ok.ru+ , id : 73501622,
  • Reid Connor: : www.vk.com/id221055117.
  • : 10.12.1980 .., : ,
  • : : www.vk.com/id220604227.
  • : 1974 .., : 9. :
  • "-" ( "-"): .: 04.08.2011 ., : 2536101639, : 1022501297609, : 081601001, : .2 .21.1 08.08.2001 129-, : 358000, , , 2.1.5.
  • : 01.01.1900 .., : , - 5922084501, 0, : , 11, 0193, 1990 .., : 0, 643333.
  • INSTITUTO SUPERIOR RELACIONES INTERNA RAUL ROA GARCIA: .: 8319498, : , VEDADO, CALZADA #308 H E I VEDADO
  • : : www.vk.com/id220744659.
  • ˲ ²˲ ˲: : 2454720236, 17.03.1967 .., .ȯ - .., : ,
  • : 9.2.1972 .., : www.vk.com/id146656161.
  • : 25.04.1920 .., : , . .16
  • : , . . 45 ,
  • "" - "": , .: 05.02.2003 ., : 840000 ., ./: 322-98-19, 322-98-19, : - , : 7813116519, : 50881000, : , : 197022, 197022, 322-98-19.
  • Angelochek Inna: 14.6 .., : ?, : www.ok.ru+Angelochek Inna, id : 27750587, : http://vkontakte.ru/app249481.
  • : 13.11.1977 .., : , , ().
  • Pholbun Pramot: : www.vk.com/id220582166.
  • : 16.06.1980 .., : , , ., 4. : . N7 //, : 160555 . , 8 .
  • : : www.vk.com/id220214091.
  • : 26.11.1974 .., : , . .30
  • : 26.09.1986 .., : , .144
  • : 12 .., : ., , : 432030-01, 49764, 1989 ..,
  • : 21.2.1999 .., .: 89673355873, : www.vk.com/id220829127.
  • : 25.10.1999 .., : www.vk.com/id220917477.
  • : 14.10.1934 .., : , . .20
  • : 201075 .., : ., . .7 .., : 21011, 56464, 1978 ..,
  • : 22.12.1913 .., : ., . -, 27
  • XUZHOU City Pacific ocean Wire frame Engineering Co.,ltd.: : LIN,QI, : rack structure , meshwork system and auxiliary facilities design manufacturing, : , 221005, Jiangsu, Xuzhou, No. 28, JIEFANG BEI Road, .: (516) 3715892.
  • : : ., .16. .2
  • : 08.02.1926 .., : , , ., 21. : () , : , 1-, .: 369850
  • : 19.08.1975 .., : , - 5622281002, 0, 0, : OPEL, KADETT, 9015, 1985 .., : W0L000036F2720481.
  • : 22.10.1923 .., , . . 11, . (495) 3080507.
  • : : BiG, .: 89172766507, : www.ok.ru+ , id : 73657199,
  • : .: 89088728511 , : www.ok.ru+ , id : 73344467, : www.vikvaz2106.ucoz.net.
  • Heuvel J P J: .: 152562433, : , , 2625LR, Delft, Gerbrandylaan, 34.
  • : : www.vk.com/id221049320.
  • -: 28.04.1966 .., . , . .23
  • : 16.05.1939 .., : , , , 73
  • : .: 8 (3812) 134835, : , ., 15
  • : 21.01.1956 .., : FOCUS, -, 198152, X9FHXXEEDHAP08864, 2010 .., : , . 100
  • : 27.02.1968 .., .., : 424037 . - . . 17, : 1215037789, - '- 1' .
  • : 11.05.1988 .., , . . 1, . (495) 2835929.
  • : 02.04.1935 .., . , . .31
  • : 16.04.1979 .., : ., . -, 7
  • : 20.02.1926 .., : , , -.
  • : : www.ok.ru+ , id : 3152737,
  • SUZHOU City JINCHANG District XINXIN Cutter Wire & cable JIAOZHI Workshop: : SHI,QUANNAN, : processing, : , 215008, Jiangsu, Suzhou, No. 31, DANYANG MATOU, .: (512) 5512561.
  • : 01.06.1954 .., . , . .29
  • : 24.07.1970 .., : ., .- . - 65 - 81, : 2115, 39978, 2001 .., : XTA21150012951034, 3077628.
  • Skvortsova Yana: 17.12 .., : www.ok.ru+Skvortsova Yana, id : 3228364,
  • : 21.04.1990 .., : -, .
  • - : 8.2 .., - .., : www.ok.ru+- , id : 3280087,
  • : 17.11.1929 .., . , . .35 .3
  • : 13.7.1989 .., : , : www.vk.com/id146749307.
  • : , .45 . : : , : 22.04.1987, : 2, :
  • As Dj-Beki: : www.vk.com/id220352814.
  • : 8.5.1987 .., : www.ok.ru+ , id : 73457134,
  • : : www.ok.ru+ , id : 73833657,
  • : 03.03.1946 .., : , , , 1
  • 18.10.1968 ..: : ., . . .18
  • : : www.vk.com/id146924823.
  • : 10.11.1991 .., : ., 69 .: 314626
  • : 13.05.1998 .., : , . .11 .1
  • : - .., : www.vk.com/id146821230.
  • : 16.12 .., .: 89181433978, : www.vk.com/id219993052.
  • : 8.1 .., : www.vk.com/id220112333.
  • : 07.12.1956 .., : , . .8 .5
  • : 18.03.1933 .., : , , , 2, : 214122, 978178, 1996 .., : 2141220578694.
  • : 01.11.1964 .., : 21103, -, 10652, XTA21103030628855, 2003 .., : , . 18
  • : 18.8.1964 .., : www.vk.com/id220836176.
  • Ardalan Ardalan: 6.7.1989 .., : www.vk.com/id220609580.
  • LIANYUNGANG City GAOGONGDAO School: : ZHANG,ZEGUANG, : put into effect education , society transportation up to grade talent, : , 222045, Jiangsu, Lianyungang, GAOGONGDAO Town, .: (518) 2540634.
  • : 3.10.1988 .., : www.ok.ru+ , id : 3252758,
  • : : www.vk.com/id146923413.
  • : 24.6 .., - .., .: 89257157435, : www.vk.com/id146676292.
  • : 31.10.1974 .., : 446250, , , , -, , , 16, : 6736, , , 115863 *, 246413, 246413, 256649, 1979 ..
  • : .: 8 (921) 6360998, 4402379, 4402379
  • : : www.ok.ru+ , id : 73560724,
  • : 13.01.1962 .., : ,
  • : .: 8 9084487689, : , , 99
  • : The White Space, 9304, Office & Administration, Alternative & Complementary Medicines & Therapies, : , , 10 Dover Road, Sheffield, South Yorkshire, Yorkshire & The Humber, S11 8RH, S11 8RH, Yorkshire & The Humber, South Yorkshire, Sheffield, .: 441142687255, www.thewhitespace.co.uk, : Mr J Easten (Proprietor)
  • Bdfyjd Lfybk: : www.ok.ru+Bdfyjd Lfybk, id : 73709193,
  • Asd Asd: : www.ok.ru+Asd Asd, id : 73533046,
  • : : 1699513553, 13.07.1946 .., ʲ - .., : , ʲ
  • : 3.11.1977 .., - .., : www.ok.ru+ , id : 27916578,
  • Ѳ : 24.03.1963 .., : , - 5640300000, , 83, : , 21093, 57345, 1990 .., : B/N.
  • : : , . . 1 . 4 . . 1 . 4, . (495) 1827639.
  • : 10.02.1980 .., : ., .- . - 19, .: 8 (812) 4828913, : 2106, 62278, 2001 .., : 21060014327998, 6370743.
  • : Sosnovka - .., : www.vk.com/id146793127.
  • : 23.9.1992 .., - .., .: +77757120992, : www.vk.com/id220261518.
  • : 13.07.1977 .., . , ., .6,
  • : 14.09.1905 .., , . . 52, . (495) 1945206.
  • - : , .: 26.11.2002 ., : 0 ., ./: 77-24-23, 77-24-23, 77-24-23, 77-24-23, : - , : 0, : 00092114, : (, , ), , , : 398600, 77-24-23, 398600, 77-24-23.
  • 13.11.1951 ..: : ., . .30
  • : 19.03.1963 .., : , , , 3. : / 000
  • : - .., : www.vk.com/id220882097.
  • : : 3119917830, 02.06.1985 .., Ͳ - .., : ,
  • ò Ѳ: 01.01.1900 .., : , - 5925386600, ., .., : , 2, 9652, 1979 .., : 0, 3369.
  • : 04.02.1994 .., : - .7 .4
  • : , . . 2 ,
  • Dz ˲ : : 1002810379, 16.06.1927 .., - .., : , Ͳ
  • : 18.01.1978 .., : .20 ; .20
  • 02.06.1945 ..: : ., . .37/45
  • : 31.05.1991 .., : ,
  • Vachrushev Vladimir: : - !, : WoT, - .., : vova_043, : www.ok.ru+Vachrushev Vladimir, id : 73312104,
  • : 14.11 .., : www.vk.com/id146913224.
  • : : www.vk.com/id221023348.
  • Mama Mumu: : www.ok.ru+Mama Mumu, id : 73822943,
  • : 09.10.1954 .., , . . 8, . (495) 1772355.
  • : 28.06.1960 .., : , 4- . .23
  • Correia-dos Santos C M: .: 299461391, : , , 1447LA, Purmerend, Lauwersmeer, 43.
  • : 13.2 .., : www.vk.com/id146665389.
  • Huseynova Sevinc: : www.ok.ru+Huseynova Sevinc, id : 73430957,
  • : 28.3.1986 .., : www.ok.ru+ , id : 3134005, : vkontakte.ru/serbriconde.
  • Fahmy Marsel: : www.vk.com/id220794561.
  • : 05.12.1999 .., : , . . 7 . 2, .: (495) 3072879
  • : : 1278533251, 02.01.1935 .., ' - .., : ,
  • ..: : , .54, .: 8 (8442) 343736
  • : : 3136913339, 19.11.1985 .., - .., : ,
  • : 3.2.1994 .., : www.ok.ru+ , id : 27723741,
  • : 3.4.1982 .., - .., : www.ok.ru+ , id : 27849488,
  • : 23.01.1983 .., : , , , 346000, , , .21
  • : : www.vk.com/id220975618.
  • . $ohka: : www.vk.com/id146912622.
  • : 22.07.1956 .., : , .7
  • /: .: 8 (4922) 292095
  • : 26.3.1993 .., : www.vk.com/id146845849.
  • : 29.2.1976 .., : www.vk.com/id221158208.
  • : 17.9.1956 .., - .., : www.vk.com/id220960637.
  • : : www.ok.ru+ , id : 3286523,
  • : 25.06.2003 .., : , , , ., ., 117
  • Seftgyry Rgreyeryer: : www.ok.ru+Seftgyry Rgreyeryer, id : 73340309,
  • : 7.4 .., : www.vk.com/id220464143.
  • : 21.01.1941 .., : , , ().
  • Almeida Reinaldo: : www.vk.com/id221165475.
  • : : www.ok.ru+ , id : 73488235,
  • : Hammonds Furniture, 3614, Shops & other Retail Outlets, Bedroom_Planners_Furnishers, : , , Care Of Joplings, John Street, Sunderland, Tyne and Wear, North East, SR1 1DP, SR1 1DP, North East, Tyne and Wear, Sunderland, .: 441915142788, : Mrs C Jennings (Area Manager)
  • : 19.02.1972 .., : , , , 10
  • : 15.04.1978 .., : , . - .8
  • : 17.10.1987 .., .: 9090022259, : www.ok.ru+ , id : 73175484,
  • : : www.vk.com/id219982014.
  • Carabaa Deacal Enrique: : 28029, Madrid, .: +34 913.152.672
  • : 13.06.1973 .., : , , -( -).
  • : : www.ok.ru+ , id : 27974672,
  • : : , : , : , : , : www.ok.ru+ , : , : . . , id : 73721187, : ,
  • : 09.10.1940 .., : , . .10 .1
  • : - "". : , , 70. : 840000 .
  • : 01.01.1900 .., : , - 5923582900, ., ., : , 9, 3000, 1975 .., : 0, 4239.
  • : 03.05.1931 .., : ., . -, 34
  • : 22.01.1971 .., : ., , . , , .36
  • : 18.12.1985 .., : , . . 72 . . 72, .: (495) 3776137
  • : 01.01.1940 .., : ., , , 5.
  • : : www.ok.ru+ , id : 27941940, : yanastyle.vv.si, socpartnerstvo.org.
  • : : (495) 3868383.
  • : 10.12.1971 .., : .,..
  • : 18.1 .., . - .., : www.vk.com/id221173654.
  • : : www.vk.com/id220055559.
  • Rustam: : dimuhametov_rust@mail.ru
  • : 25.11.1926 .., : ., . -, 43
  • : 12.5.1967 .., - .., : www.ok.ru+ , id : 73728794,
  • : 07.04.1973 .., : , ., .12.
  • : .: 8 (921) 9505277, 1863137, 1863137, : -, 18 .1
  • Sherinbayev Sanatbek: 7.8.1995 .., : www.vk.com/id220013195.
  • : 1.3 .., : www.ok.ru+ , id : 73065048,
  • : 24.6 .., - .., : www.vk.com/id146860769.
  • : : , -, .
  • : : www.vk.com/id220204683.
  • : 11.08.1990 .., : , -
  • : 12.7 .., : www.ok.ru+ , id : 3170607,
  • : 06.04.1944 .., : , . . . 36 . . 12, .: (495) 2533856
  • : 29.06.1964 .., : ., .- - 40 - 2 - 243, : 21412, 393578, 1991 .., : XTB214120M0268473, 331-0276247.
  • : 09.05.1937 .., : , . .6
  • : : www.ok.ru+ , id : 3209030, : http://cray29.deviantart.com.
  • : : www.ok.ru+ , id : 73650377,
  • Alona: : a-poznyak@bk.ru
  • : 30.01.1974 .., : , , /, , , 7
  • : 21.12.1946 .., : ., . -, 7
  • : 18.12 .., : ,, : , : Counter Strike 1.6, Counter Stirke Sourse, Quake 3, - .., : , , , , , , : , --, -, , , , , , , , , , , , , , , , , , , , , , : www.ok.ru+ , : , , , , , : Stigmata, Linkin Park, Placebo, Evanescene, Within Tempations, LaFee, AFI, , Lady Gaga, , , Die Allergie, Fall out boy, , Apshell, id : 3070284, : [BOYs], [TRASH], [MUSIC], [LAMBORGHINI], [DOGs], [COMP], [PHOTOSHOP], [], [], [], [], [], [], [], [], [], [ ], [], [ ], [BRAVO], : http://vampirefreaks.com/KuzliA.
  • : : , : Gta, doom, - .., : , : , , , 1, 2, 1, 2, : www.ok.ru+ , : , : , R&,B, id : 73833334, : , , ,
  • : 06.05.1969 .., : -21063, -, 195, 59, XTA210630J1932480, 0092170, J1932480, 1988 .., : , , 35
  • : 3.9.2000 .., - .., : www.vk.com/id220954190.
  • : . , . .58
  • -: 01.01.1939 .., : ., , , 9.
  • : 12/11/56 .., : ., . , , 34
  • : 28.05.1957 .., : , . .13/1
  • : 17.03.1947 .., H . . H H - .., : , , 66.
  • : 14.2.1983 .., - .., : www.vk.com/id220410266.
  • : .: 8 9502863193, : , 2- , 15
  • : 04031982 .., - .., : . . .20
  • : 16.05.1983 .., - .., .: 8 (4842) 121897, : : (), : ., -: , , , 6\1
  • Kmetovski Dean: 16.4.1990 .., : www.vk.com/id221176057.
  • : 20.10.1987 .., : (), . , 92
  • Odna-Takay Lerok: : www.vk.com/id220907423.
  • : 01.01.1923 .., : , . . . 14, .: (495) 4654043
  • : .: 8-931-5016375 (), 89114493056, : ., ., 3
  • : 11.04.1962 .., : , . .40 .3
  • : 17.05.1945 .., : , , 1 -23, 21.
  • : 11.03.1961 .., : , , , 21
  • : 10.04.1956 .., : 3, 6988, , 1986 .., : 3025, 7030, : , 50 ., 29.
  • : 8.6.1985 .., : www.vk.com/id146708710.
  • : : ., -19 4- .2
  • Ѳ : : 3048125110, 15.06.1983 .., - .., : , ª
  • : 08.07.1975 .., , 2- . . 1, . (495) 9630465.
  • : : , 3/1, .: 8 (383) 189562.
  • : .: 8 9069878562, : . . 1
  • : : www.ok.ru+ , id : 73832012,
  • : : www.ok.ru+ , id : 73587428,
  • : : www.ok.ru+ , id : 27969238, : www.krasavshik.ru.
  • : ..: 8 9047688751, : , 420075 13
  • : 30.3.2000 .., - .., : www.vk.com/id220166325.
  • : 3.3 .., : www.ok.ru+ , id : 3172171,
  • : 08.07.1974 ..
  • : 15051959 .., - .., : - . . .12
  • Ͳ : : 1187708251, 08.07.1932 .., - .., : ,
  • : : ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, : ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, : ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, : ,,,,,,,,,, : www.ok.ru+ , : ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, : ,,,,,,,,, id : 73085550, : ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,
  • : : 2781924450, 01.03.1976 .., ʲ - .., : , ʲ
  • : 10.02.1939 .., : , . 140
  • Rad Alex: : www.ok.ru+Rad Alex, id : 73129175,
  • : : www.ok.ru+ , id : 73248084,
  • : : 1939521298, 06.02.1953 .., - .., : , IJ
  • : 08.04.1961 .., : ., .280
  • : 25.8.1982 .., : , : ++>=, : , - .., : , .: 89600484283, : NFS, , : www.ok.ru+ , : , : , id : 27746440, : , : .
  • Perepil Kirill: : www.ok.ru+Perepil Kirill, id : 73231191,
  • : 29.03.1971 .., : 11183, -, 54452, XTA11183070085883, 2007 .., : , 4
  • : 01.01.1936 ..,
  • Fsadf Sadfsadf: : www.ok.ru+Fsadf Sadfsadf, id : 73703605,
  • "" ( ""): .: 01.09.2011 ., : 1435225160, : 1101435001470, : 143501001, : 98401000000, : .2 .21.1 08.08.2001 129-, : 677000, // , , , 7.
  • : .: 1533639, : , , . . 13
  • : 31.03.1916 .., : , . . 23, .: (495) 3522484
  • : : 26.06.2002, , , (), .: 8254-, 8254-21630, : , 247820 .,. ..,2;
  • : 07.11.1978 .., : ,
  • : 09.07.1922 .., , . 36, . (495) 4866042.
  • : .: 326155, : , .. 47-
  • : ..: 8 9178657884, : , . -, -, -, . , . ,
  • : 10.9.1991 .., : www.vk.com/id220078016.
  • : 14.4.1983 .., - .., : www.vk.com/id220762434.
  • : 8.8.1999 .., - .., : www.vk.com/id220796035.
  • : 18.02.1945 .., : ,
  • : : www.vk.com/id220662260.
  • Pop Lolly: 28.5 .., : |DELT|, : www.ok.ru+Pop Lolly, id : 73139573,
  • "" - "": , : 850000 ., ./: 234-62-91, 234-62-91, : - , : 7826691812, : 49002192, : , : 190068, 190068, 234-62-91.
  • Love quest : 11.12 .., - .., : www.ok.ru+Love quest , id : 73578543,
  • : 23.06.1945 .., H- -H H - .., : (.: 31.08.77 HH H) 33, .
  • : : T, : www.vk.com/id146862473.
  • : 22.12.1998 .., : , 1- . .5
  • : 27.10.1953 .., : 2106, 94302, , 1995 .., : XTA210600T3543639, 3543639, 3995836, : , , , 28.
  • : : www.vk.com/id220696131.
  • в: 12.05.1977 .., : , - 5640100000, I, 1, : FORD, TRANSIT, 62413, 1996 .., : WFOLXXGBBVLTY03000.
  • : 28.03.1954 .. : .
  • : : , . 6
  • : 05.06.1962 .., , . . 17, . (495) 4076121.
  • : .: 8 (8312) 310785, : . , , 144
  • : 29.04.1948 .., : , , , ., 1. : . .-, : , 682800,., .,8, : .., .: 4-42-40.
  • : 1974 .., : , , .
  • : 01.03.1913 .., . , . .16 .3
  • : 29.3 .., : www.vk.com/id220637388.
  • ʲ : : 458000971, 16.07.1912 .., - .., : ,
  • : 07.08.1973 .., , . . 27, . (495) 3930712.
  • : 14.07.1983 .., : , 2-, 3, .: 8 (3812) 90, : , 980355, 98_ ..
  • : 06.05.1923 .., : . -, -, ., 35, .: (812) 5861135.
  • : : www.vk.com/id220520159.
  • ̪Ǫ Ͳ : : 2662419616, 22.11.1972 .., - .., : , ֲ
  • Ͳ: 15.06.1929 .., : , - 5922386401, , : , 21103, 44741, 2001 .., : XTA21103010300574.
  • : 24.6.1981 .., : www.vk.com/id221072537.
  • : 07.08.1952 .., H H -H - .., : (.: 16.12.2002 H .H) 6, .
  • : 29.01.1981 .., : .
  • : 3.5.1987 .., : www.ok.ru+ , id : 3149740,
  • : 6.8 .., : www.vk.com/id146584825.
  • : 08.03.1926 .., . , . .78
  • : 19.06.1953 .., : 21013, 7711, , 1985 .., : 4647633, 8360850, : , , 24.
  • : 10.03.1985 .., , . . 18, . (495) 4813939.
  • .. ., - 25 (2000.02.01 ): .: 8 (473) 26763760
  • : 05.08.1978 .., : , , 13.
  • : 20.3.1991 .., : , - .., : , , : www.ok.ru+ , id : 27740470, : , ,
  • : 10.05.1932 .., : ., --, , 22.
  • : .: =))))))), : www.ok.ru+ , id : 73347397,
  • : 13.02.1942 .., : , . .27
  • ˲ ²˲ : : 3161015016, 18.07.1986 .., - .., : ,
  • Ъ : : 3622900878, 11.03.1999 .., Ѳ - .., : , Ѳ
  • : 15.10.1966 .., : , . . 26, .: (495) 4816794
  • Brunetka Sashenka: : www.vk.com/id146842515.
  • : 17.12.1973 .., : , . .11 .1
  • ""): .: 29.06.2011 ., : 3307018324, : 1113334001626, : 330701001, : .2 .21.1 08.08.2001 129-, : 602267, , 7.
  • : 13.08.1981 .., : , . . 30, .: (495) 9027647
  • : 26.06.1922 .., : , . .10 .1
  • : : www.ok.ru+ , id : 27719955,
  • CHANGSHU City RISHAN Toys Co.,ltd.: : JI,JIAN, : toys . garments . shoes and caps and toys raw materials and auxiliary materials manufacturing processing, : , 215516, Jiangsu, Suzhou, XINGLONGSI YINGJING JICHENG, .: (520) 2348181.
  • Wong Angus: : www.vk.com/id220515242.
  • ..: , . . 6 ,
  • : 20.11.1956 .., , . . 27 . 2, . (495) 3578189.
  • : 24.10 .., - .., : elena197919831, : www.vk.com/id221032496.
  • ..: .: 8 (3812) 535814, : , 136.
  • : : www.ok.ru+ , id : 3082869,
  • : : www.ok.ru+ , id : 73188657,
  • : 22.10.1986 .., : :))))))))), - .., : www.ok.ru+ , id : 3169008,
  • Muslimah Ghariba: : www.vk.com/id220510073.
  • : 26.1.1998 .., : , : , - .., : , .: 1164549, : , , 2, , , , , , : www.ok.ru+ , : , : , , id : 73544574, : ,
  • : .: 8 9065311310, : . . 11
  • : .: 89144792303 (), : . (.), . . .,
  • : TOYOTA CARINA, (), , , , 256628, 1991 .., : , :
  • "" - "": , : 1000000 ., ./: 445-15-64, 445-15-64, : - , : 7814095300, : 49018750, : , , , : 190031, 190031, 445-15-64.
  • : .: 89095119089 (), : . - 53
  • "" - "": , , : 7720267836
  • NANTONG City CHONGCHUANLAO SHUGEN Hotel: : CAI,XIA, : food and drink, : , 226007, Jiangsu, Nantong, ZU, 1, ZHONGXIU LIANHE Village, .: (513) 3570942.
  • Zakaron Hak8: : www.ok.ru+Zakaron Hak8, id : 73139982,
  • : 23.01.1952 .., : , ., .13, .1.
  • ˲: : 2551416491, 08.11.1969 .., Ͳ - .., : , в
  • : - .., : www.vk.com/id220220406.
  • : 24.11 .., - .., .: http://vk.com, : http://vk.com/id220309836, : www.vk.com/id220309836.
  • : 01.01.1922 .., : ., --, , 146.
  • Uzakov Azat: : www.vk.com/id146647336.
  • : : www.vk.com/id220907627.
  • : : www.vk.com/id220518883.
  • ĸ @: : www.ok.ru+ĸ @, id : 73378021,
  • : : www.ok.ru+ , id : 73492112,
  • : : www.vk.com/id220615720.
  • : : , : www.ok.ru+ , id : 73689771,
  • : 02.05.1951 .., : 2101, 3025, -, 1974 .., : 1045180, 1028518, 1115302, : , ., , 42.
  • : 09.01.1931 .., :
  • : 16.03.1970 .., . , 21
  • Avagyan Nare: - .., : www.ok.ru+Avagyan Nare, id : 73453152,
  • : 26.10.1978 .., : www.vk.com/id220590290.
  • : .: 8 9069817771, : . . 46 .-
  • : 25.11.1936 .., : , , .
  • : 07.08.1962 .., : , . . 7, .: (495) 2992558
  • : : , 12.
  • : 7.5.1985 .., : www.ok.ru+ , id : 3164847, : www.sports.ru.
  • : .: 8-921-1357252 (), : ., . , 1
  • : : , . 14,.7
  • : 01.03.1953 .., : , , .( -).
  • IJ: : 3186712895, 01.04.1987 .., ղ - .., : , ˲
  • : : www.vk.com/id221061049.
  • ̲ ò ˲: : 3137614896, 26.11.1985 .., - .., : ,
  • : 15.4.1991 .., : www.ok.ru+ , id : 3107032, : ---.
  • : 07.05.1978 .., . , . . 25 .24
  • : 29.03.1975 .., : , .
  • : : www.vk.com/id220614280.
  • : 24.06.1934 .., : ., . -, 6
  • : 11.06.1964 .., : ., .- . , .: 8 (812) 1531065, : 320, 60178, 1985 .., : W31009137358, 9137358.
  • : 18.5 .., - .., : www.vk.com/id221108834.
  • : 15.05.1960 .., : , , ., 49. : 15
  • : 8.6.1980 .., - .., : www.ok.ru+ , id : 27889333,
  • : .: 89261664166 - Macbook pro'15 2012 . . 16. ( , 2x2GB 1600MHZ 12800PC, , : > , : 1500 .), : , .
  • A: : ., 2103 ( ) , - , 1974 .., : , : 84340, 66840, 2103-0135887, 0133120, :
  • : 23.07.1974 .., , . . 10, . (495) 3002892.
  • : : 3088822733, 26.07.1984 .., - .., : , .ȯ
  • Abdilakimova Zirek: : www.vk.com/id146828044.
  • : 13031976 .., : ., .76.786, : 21074, 47664, 2008 .., : XTA21074082692427.
  • : 19011958 .., - .., : - . . .10
  • : 27.9 .., : www.ok.ru+ , id : 73149057,
  • : : 3248608054, 10.12.1988 .., - .., : ,
  • : : www.vk.com/id221140520.
  • : 22.08.1957 .., : ., . -, 5
  • : 02.06.1951 .., : . . 18, : -969, 5881, 1988 ...
  • : 5.11.1991 .., : >,^.^<, <, >,^.^&,, : www.ok.ru+ , id : 3262039,
  • : 22.09.1971 .., , , - .., :
  • : 2.7.1980 .., : www.ok.ru+ , id : 73460235,
  • в ò: : 3083220591, 31.05.1984 .., в - .., : , в
  • : , . . 8, . (495) 2679849.
  • : 15.04.1931 .., H .- H -H - .., : (.: 04.11.2002 .HH H ) 4, .
  • : 10.08.1937 .., : ., . -, 51
  • : 4.2.1989 .., - .., : www.vk.com/id221152017.
  • : : www.vk.com/id220212315.
  • : : www.ok.ru+ , id : 73354107,
  • : : www.vk.com/id220455218.
  • : : www.vk.com/id220039346.
  • : .: 8 9246710969, : , 50 ;, 67
  • : 23.7 .., - .., : www.vk.com/id221073538.
  • : .: 8 (812) 5401196, .: 9426231 (Tele2), : , -, 31
  • : 17.08.1938 .., : ., . . . 52.
  • : , . . 6, . (495) 4974522.
  • : 19.3.2000 .., - .., : www.vk.com/id220741386.
  • : 18.02.1969 .., : 21102, 61702, --, 2111, 2001 .., : XTA21102020385613, 0385613, 0414384, : , , , 7.
  • Omar Saya: 27.7 .., : www.vk.com/id146607448.
  • : : www.vk.com/id146681358.
  • : 25.06.1946 .., H . H - .., : (.: 12.09.2002 H . H) 4, .
  • Х: 11.11.1911 .., : , - 5640700000, , 4, : OPEL, KADETT, 9419, 1981 .., : WOL000043H5090149.
  • : : www.vk.com/id146891221.
  • : : www.vk.com/id220251087.
  • Vladik Vladik: 21.12.1998 .., : www.vk.com/id220157677.
  • Huseyinov Mehemmed: 16.5.1998 .., : www.vk.com/id220401821.
  • ? : : , : www.vk.com/id146785643.
  • : 16.02.2006 .., : ., , . , , .22
  • : 10.9.1994 .., : |DOG|, .: 80963291***/80994974***, : www.ok.ru+ , id : 73412717, : http://vkontakte.ru/id73412717.
  • ò ²: 11.11.1911 .., : , - 5640100000, I, 16, : , 157, 02631, 1967 .., : 0, B/N.
  • : , . . 81 ,
  • : : www.vk.com/id220549400.
  • : 18.07.1984 .., , . . 10, . (495) 3910164.
  • : Amerling: : Private Limited Company, : 1992 ., : Raagu 33-12, Tallinn 13417 Estonia, Raagu 33-12, Tallinn 13417 Estonia, : Viktor Saar - chairman, : 3725013193, amer2002@hot.ee, http://www.amerling.ee, : Road haulage, part loads, (), , : 17 : 395000 EEK (32640 $) : 6644000 EEK (549090 $).
  • : 8.11.1983 .., - .., : www.ok.ru+ , id : 3195579,
  • : : www.vk.com/id220119878.
  • ..: : , , 130, .: 8 (846) 3333138.
  • : 08.04.1958 .., : ., , , .34
  • : 12.2.1989 .., - .., : www.vk.com/id146842577.
  • Castro Escabias Rafael: : 28905, Getafe, .: +34 916.828.554
  • : - .., : www.ok.ru+ , id : 73625872,
  • : 08.05.1953 .., : , , , 10
  • Fdsfgds Gfds: : www.ok.ru+Fdsfgds Gfds, id : 73867155,
  • : : www.vk.com/id220927854.
  • : 08.09.1978 .., . , . .4 .3
  • : .: 8 (812) 2453927, .: 9320531 (Tele2), : , -, - 73
  • Smart Service Group: .: +7 (903) 179-19-99, : , . 2- , 5, @-www: ssg@ssgproject.ru, ssgproject.ru, : , , , , ,
  • : 02.05.1955 .., : ., .- , .: 8 (812) 1443867, : , 52778, 1989 .., : WVWZZZ31Z120389, 06410.
  • : 04.09.1957 .., : 8122, 139302, , 1998 .., : F812200W0015891, W0015891, : , , , 36.
  • "-" - "-": , : 12000000 ., ./: 234-44-45, : - , : 7813109913, : 49011044, : , : 197022, 000000.
  • Ҹ: : www.vk.com/id220416749.
  • : 2.3.1994 .., : www.vk.com/id220542686.
  • : : www.ok.ru+ , id : 73265426,
  • : : www.vk.com/id220469120.
  • : M & M Bakery, 5224, Shops & other Retail Outlets, Bakers' Shops, : , , 11 Hildreth Street, London, London, SW12 9RQ, SW12 9RQ, London, London, .: 442086731989, : Mr W Mundle (Manager)
  • Raducu Madalina-Elena: 24.2.1995 .., : www.vk.com/id220014443.
  • EMIL LUX GMBH & CO. KG - , : 42929 WERMELSKIRCHEN EMIL -LUX-STR. 1, : < >, : 125252, , . , . 12, : - 8(926) 246-17-08, : , 0,25 .% , 0,8 : - EMIL LUX GMBH & CO. KG, LUX TOOLS
  • : : www.vk.com/id146836051.
  • : 20.09.1954 .., . , 24
  • : 24.04.1963 .., : , .
  • : 01.01.1925 .., : , . .3 .2
  • : 01.01.1900 .., : , - 5922680400, .Ͳ, ., : , 2, 2289, 1972 .., : 0, 4000.
  • : 2.8.1981 .., : www.ok.ru+ , id : 3225567,
  • : 11.03.1954 .., : ., . -, 53
  • : : www.vk.com/id221154439.
  • : 1972 .., : , , 100.
  • () : .: xxxxxxxxxxxxx, : www.ok.ru+ () , id : 73288631, : .
  • : 04.12.2003 .., : , -, , 39
  • : : www.ok.ru+ , id : 28043159,
  • : 01.09.1939 .., : , .6 .605
  • : .: 8 9147943354, : , ,. , 1
  • : : . , : www.ok.ru+ , id : 28059381,
  • : : , . . 30, . (495) 1465262.
  • () : : 123007, , 1- ., . 22, . 1 , : ./.2590723, : - .
  • : 28.10.1951 ..
  • : - .., : www.vk.com/id220422386.
  • : 20.10 .., - .., : www.vk.com/id146866002.
  • ² в ²: : 1136911310, 16.02.1931 .., Ѳֲ - .., : ,
  • : : 369302233, 10.02.1910 .., - .., : ,
  • : : www.ok.ru+ , id : 73744403,
  • ..: : , 21, .: 8 (3452) 244708.
  • : : , 60, .: 8 (383) 428185.
  • : 20.10.1928 .., : , . .8 .2
  • : 03.06.1951 .., . , . .30 .1
  • ? : : www.ok.ru+? , id : 73422621,
  • : : 1369319652, 28.06.1937 .., - .., : ,
  • : 18.09.1960 .., , . . 7 . 2, . (495) 4433780.
  • : : www.ok.ru+ , id : 73169520,
  • Marius Marius: : www.vk.com/id220964516.
  • в ²˲: : 3151715974, 16.04.1986 .., - .., : ,
  • ( .):
  • : : www.ok.ru+ , id : 27907375,
  • : 1932 .., : ., , , , 54
  • Kucinskas Mindaugas: 2.3.1988 .., : www.vk.com/id220679589.
  • JIANGYAN City JIANGYAN Town Agriculture machinery Management Service station: : PAN,ZHONGHOU, : agriculture machinery management . service . technology promoting, : , 225500, Jiangsu, Taizhou, No. 14, East Suburb TONGYANGXIN Village, JIANGYAN Town, .: (523) 212548.
  • : TOYOTA LITE ACE, (), , , , 23625, 1990 .., : , :
  • : 10.04.1950 .., : , . .3
  • 26.06.1968 ..: : ., . .103
  • . . .: 06.05.1953 .., : , .60. .23 .2
  • : : www.ok.ru+ , id : 73084880,
  • : 13.10.1961 .., : , - , , , 7, : 21061, 616, 1998 .., : 5068172, 4041387. : , - , , , 5, : ."", : 6601, 4698, 1981 .., : 31590890
  • 9600629398 PRE_PAY: ..: 8 9600629398
  • : 11.05.1975 .., : . -, -, ., 26, .: (812) 5292406.
  • : 19.12.1985 .., : ., . -, 4
  • : 8.1.1999 .., - - .., .: +7 , : www.vk.com/id220286669.
  • Aydin Ismail: : www.vk.com/id220522457.
  • ..: : , . . 6 ,
  • : 12.1 .., - .., : , , : www.ok.ru+ , : , id : 3235307,
  • : 18.03.1987 .., H . H - .., : (.: 22.08.2007 H -H ) 63, .
  • : , . . 129, . (495) 7152283.
  • : : . 20, .: 8 (383) 3504917.
  • : 16.05.1978 .., : , , , 238.
  • : 27.11.1956 .., : ., , . , , .24
  • : : www.ok.ru+ , id : 27870508,
  • : 27.02.1921 .., : - , ., ., 27
  • : 08.04.1978 .., , . . 19, . (495) 4585065.
  • : : . 14 - 55, : VOLKSWAGEN-PASSAT 1993 ., 1781 ., -66 (90 /).
  • : 07.10.1986 - .., : .-, . . 7 .3
  • : 28.06.1975 .., : , : .,
  • Gerasimov Pawa: : www.vk.com/id221036150.
  • Viola Yuri: : www.ok.ru+Viola Yuri, id : 73480151,
  • Dz : : 3377205515, 18.06.1992 .., ͪ - .., : , ͪ
  • : 13.04.1972 .., : , , , 8
  • : 26.08.1998 .., : , , , 2/
  • : , -3 .2 . : : , : 23.07.1992, : 2, :
  • : Anderson W B, 5131, Head Office, Fruit & Vegetables - Wholesale, : , , Low Harker, F P L Buildings, Carlisle, Cumbria, North West, CA6 4DP, CA6 4DP, North West, Cumbria, Carlisle, .: 441228674797, : Mr Brian Proudfoot (Director)
  • : .: 8-921-6801217 (), 9218294322, : ., - - .. ., 31
  • : 08.03.1953 .., : , - - ..-, , 51. : "- - "
  • : : www.vk.com/id220121258.
  • Talinikova Catherine: : www.ok.ru+Talinikova Catherine, id : 73306601,
  • : 29.3.1993 .., : **, .: 1*15*7* - , : www.ok.ru+ , id : 73097433, : http://.
  • Asaf Abo: : www.vk.com/id220749015.
  • "" 7723588362 1067757905929: ./: 5389651, 0, : 109651, , , 20, 3, 564.
  • : .: 8 (812) 1749666, .: 6476768 (Tele2)
  • : : anonelbe276@mail.ru
  • Nazaretyan Narek: : www.vk.com/id220980347.
  • : 03.05.1986 .., : , . .23
  • : TOYOTA CRESTA, (), , , , 54425, 1989 .., : , :
  • : : www.ok.ru+ , id : 27747750,
  • : 23.01.1973 .., : , . .13 .2
  • : 01.01.39 .., : , , ., 41.
  • : : www.ok.ru+ , id : 27857634,
  • : 16.2.1989 .., : www.ok.ru+ , id : 3138886,
  • , : , . , 40- .
  • Kugt Kugt: : www.ok.ru+Kugt Kugt, id : 73406242,
  • : 16.06.2000 .., : ,
  • WUXI City NANYANG Materials Co.,ltd.: : WU,MIN, : metals material , hardware, mechanical and electrical products , chemical building materials, : , 214031, Jiangsu, Wuxi, No. 29, QIANJIACHENG, .: (510) 2711483.
  • : 10.02.1951 .., : , . .13 .3
  • Kavkaza Krasivie: : www.vk.com/id220416667.
  • : .: 8 (921) 9428748, 307-9665, : C-, 33/4
  • : 13.11.2000 .., - .., .: , : www.vk.com/id221120380.
  • : .: - :D, : www.ok.ru+ , id : 73075768, : nety.
  • Stewart Kristen: 9.4 .., Los Angeles - .., .: , : www.vk.com/id221171877.
  • : Burntwood Brake & Clutch Services Ltd, 5013, Motor Vehicle Supplies & New Parts, Motor Accessory Distributors. Subject Specialises In Brakes And Clutches, : , , Ring Road, Burntwood, Staffordshire, West Midlands, WS7 3JQ, WS7 3JQ, West Midlands, Staffordshire, Burntwood, .: 441543684528
  • : : www.ok.ru+ , id : 27979683, : ....
  • : 19.03.1986 .., : ., , . , , .9
  • : .: 8 9146615014, : , , 26
  • : 01.10.1986 .., : AUDI80, , 57652, WAUZZZ89ZHA472824, 1987 .., : , 24
  • : 30.3 .., : www.ok.ru+ , id : 27960393,
  • : 22.09.1971 .., : , , , 179
  • Star Black: : www.vk.com/id220746745.
  • : 16.8.1987 .., : www.ok.ru+ , id : 27934326, : http://vkontakte.ru/app638461_27934326.
  • : 1970 .., : . :
  • : : www.ok.ru+ , id : 73192528,
  • : 09.04.1959 .., :
  • : : www.vk.com/id220451298.
  • : : www.vk.com/id220981680.
  • : .: 8 9065737379, : 193167 .- . . 4
  • : . - .., : www.ok.ru+ , id : 73257165,
  • Lisizza Ira: : www.vk.com/id146918424.
  • : 14.03.1951 .., . , . .1
  • : 01.01.1922 .., : ., , , 33.
  • : 17.09.1956 .., : , , , ., ., 29
  • : 24.05.1975 .., : ,
  • : : , : , : , : , : www.ok.ru+ , : , : , id : 73295809, : ,
  • ò : : 2951720573, 24.10.1980 .., - .., : , ˲
  • " " - " ": , .: 25.12.2002 ., : 840000 ., ./: 465-90-99, : - , : 7820024643, : 50903032, : , : 196601, 000000.
  • : : www.vk.com/id220096111.
  • Aksenova Dashka: : www.vk.com/id220685549.
  • 14.07.1922 ..: : ., . 1 . .15
  • Zizo Zam: : www.vk.com/id220087238.
  • : 6.7.1991 .., .: 0674578424, : www.ok.ru+ , id : 73189989,
  • : 22.02.1961 .., . - - ..
  • : .: 8 9024871266, : , , 53
  • : .: 89038586596 (), : ., . , . , .55
  • ˲ : : 3168512412, 01.10.1986 .., вղ - .., : , вղ
  • : : www.ok.ru+ , id : 73513372,
  • : 31.12.1982 .., : , - ., .353220, 353220 .
  • : 4.7.1993 .., - .., : www.vk.com/id220266518.
  • " ." ( .): .: 03.10.2012 ., : 6731004139, : 1026701434540, : 673101001, : 66401370000, : , : 214020, , , , 5.
  • : 17.01.1977 - .., : , 2121, , 744756, 1999 .., : .3 .0
  • : : www.ok.ru+ , id : 73853872,
  • WUXI City XIAOCHUN Materials Sales department: : XIA,HUABAO, : metals material , upholstery material , rubbers , plastic products , metals electrical appliances marketing, : , 214081, Jiangsu, Wuxi, No. 240, SUXI Road, .: (510) 5411277.
  • : 15.02.1960 .., , . . 2 . 4, . (495) 1917875.
  • Lihovoi Sergei: : www.ok.ru+Lihovoi Sergei, id : 73313656,
  • : : www.ok.ru+ , id : 73776618,
  • XISHAN City ZHANGJING NANXIN Plastic fittings Factory: : SUN,ZHENGWEI, : , 214194, Jiangsu, Wuxi, ZHOUJIAGE, ZHANGJING Town, .: (510) 3792478.
  • : ..: 8 9172584327, : , . , 3/97, . . , . ,
  • : : 2195623673, 11.02.1960 .., Ͳ - .., : , Ͳ
  • : : 3087123050, 09.07.1984 .., - .., : ,
  • ..: , . . 3 ,
  • : 22.1.1997 .., : www.vk.com/id221039882.
  • "" - "": , : 840000 ., : - , : 0, : 50006203, : , , , : 195197, 000000.
  • : 26.12.1974 .., : 652803, , , ., . .9
  • : : 3031121916, 27.12.1982 .., ˲ - .., : , ˲
  • : .: 8 (3812) 236779, : , 13.
  • : 21.10.2001 .., : , , 95
  • : 22.03.1967 .., : ., , . , 2- , .7
  • : 29.09.1976 .., : - , : , , , 49
  • : 20.02.1968 .., : , , , 80. : . ""
  • : .: 8 9242113404, : , ; , 27
  • : : www.ok.ru+ , id : 73367976,
  • : 25.08.1990 .., : , .
  • : 8.5 .., : www.vk.com/id146732453.
  • Suministros Grion SL: : 28971, Grion, .: +34 918.103.920
  • Sijnesael J A: .: 115442321, : , , 4542CR, Hoek, Korenbloemstraat, 11.
  • : 06.10.1968 .., : 330210, 85302, , 1995 .., : XTH330210S1518066, 1518066, : , , , 16.
  • : 09.01.1982 .., : 97042, , , -, ., ., 11.
  • : 19.05.1982 .., : , - , , 185.
  • : 01.02.40 .., : , , ., 2
  • : 29.11.1932 .., , . . 11, . (495) 3080643.
  • : : www.vk.com/id146529190.
  • : : www.ok.ru+ , id : 73341903, : http://vk.com/sexbomb4x4.
  • : : 3140413876, 24.12.1985 .., .ȯ - .., : , .ȯ
  • .. ( ( ..)): .: 04.03.2007 ., : 7701081240, : 5077746100427, : 770101001, : 45286555000, : .2 .21.1 08.08.2001 129-, : 101000, , , 4.
  • : 10.01.1947 .., , . . 130 . . 130, . (495) 3385658.
  • : : www.ok.ru+ , id : 73204346,
  • : 25.4.1989 .., : , : www.ok.ru+ , id : 27740992,
  • : : www.ok.ru+ , id : 73258993,
  • Bene kota Meet4el: : www.ok.ru+Bene kota Meet4el, id : 73678546,
  • : : www.ok.ru+ , id : 73662424,
  • : 16.4.1956 .., : www.vk.com/id220393064.
  • ò: : 2610520591, 22.06.1971 .., ² - .., : , ²
  • : 30071979 .., - .., : - . . .11
  • : 1958 .., : , .,,76
  • : 5.9.1990 .., - .., : www.vk.com/id221066085.
  • : .: 8 3953565503 (8 39535 65503), : , -, , 13
  • : 01.01.1900 .., : , - 5940300000, , 14, : JAWA, 250, 6895, 1983 .., : 0, 634726115.
  • : : www.ok.ru+ , id : 27747310,
  • : : , . . 7
  • : 25.08.1974 .., : , . .23
  • "" ( ""): .: 01.10.2012 ., : 7811330891, : 1057812904731, : 781101001, : 40296565000, : .2 .21.1 08.08.2001 129-, : 192289, - , , 4.
  • : : www.ok.ru+ , id : 73378969,
  • Amyotte Joel: : www.vk.com/id221096018.
  • 9069860515 PRE_PAY: .: 89069860515 ()
  • . .: : ., , , 7, .: 8 (4862) 427707.
  • : - "". : -, , 94. : 840000 .
  • Nia Kse: 29.12.1993 .., - - .., .: iPhone, : senechka-op, : www.vk.com/id221035162.
  • : : murchik, - .., : www.ok.ru+ , id : 73223354,
  • : : www.vk.com/id220134319.
  • : 20.7 .., - .., .: 38-96-54, : www.vk.com/id220359808.
  • : 08.02.1982 - .., : , , , , , 10/1, : BMW 5/H, - , P029PFM, WBAHB51030GG41773, 1994 ..
  • : 12.9 .., - .., : www.ok.ru+ , id : 73187289,
  • : , . . 1 ,
  • : 27.10.1932 .., : ., . -, 30
  • : : *Alex*, .: +79**33*8*1*, : www.ok.ru+ , id : 73758836, : vkontakte.ru.
  • : 10.10.1965 .., : , .
  • : 02.04.1957 .., :
  • : : www.vk.com/id220497089.
  • : 16.02.1930 .., : , . . 23, .: (495) 3226793
  • : 02.02.1978 .., : 628600, - - , , - ., . 19
  • : 10.8.1992 .., .: +79521367465, : pavel201148, : www.vk.com/id146758608.
  • : 09.07.1955 .., : , , 47
  • : 21.08.1964 .., : , ., 56.
  • : : www.ok.ru+ , id : 73870941,
  • Yjytd Hthyj: : www.ok.ru+Yjytd Hthyj, id : 73678156,
  • : 30.4 .., : www.ok.ru+ , id : 27747945,
  • : 20.01.1962 .., : , .
  • ò: : 3174211615, 27.11.1986 .., - .., : ,
  • : 31.01.1963 .., : , . .2
  • : 22.4 .., .: 8-963-680-57-02, : www.ok.ru+ , id : 73145380, : - - - - - - - - - - - - .
  • : 4.11.1983 .., : www.ok.ru+ , id : 3276474,
  • : 30.11.1956 .., : ., , . , 40 , .12
  • Galitskaya Maria: 22.10 .., Odessa - .., : www.vk.com/id221194085.
  • : 4.5 .., - .., : www.vk.com/id220402077.
  • : : www.ok.ru+ , id : 73399624,
  • "" ( ""): .: 19.07.2012 ., : 7505006688, : 1117505000667, : 750501001, : 76212551000, : , : 674650, , -, , , 52.
  • : 29.04.1962 .., : 540202, 3264, , 1990 .., : 75712, 2484070,
  • : 21.8 .., : www.vk.com/id219986500.
  • : 20.01.1978 .., : , , , 54.
  • : : www.ok.ru+ , id : 28049630,
  • : .: 8 (921) 9955607, 3280637, 3278886, : C-, ,7- 70 -----
  • : . , . 89
  • ²: : 3161014894, 18.07.1986 .., в - .., : , в
  • : 11.1.2000 .., : www.vk.com/id219981242.
  • в : : 3040927333, 04.04.1983 .., - .., : ,
  • Joystick Ruslan: 22.4.1992 .., : rusr-m, : www.vk.com/id220127358.
  • Janashvili Soso: 12.4 .., : so_S_oo, : iosebii, : www.vk.com/id220451737.
  • Kholod Roma: 30.6 .., : ^, : www.ok.ru+Kholod Roma, id : 73635192, : http://www.lastfm.ru/user/Roma_Kholod.
  • : 09.03.1985 .., : , . .57 .2
  • : 01.02.48 .., : , , -., 320, 46
  • : : www.vk.com/id220953888.
  • : 27.5.1987 .., : www.ok.ru+ , id : 3238151, : http://lia51.clan.su/.
  • Lal Yann: 25.10 .., : www.ok.ru+Lal Yann, id : 3123363,
  • : 01.01.1990 .., : , . .6
  • Derry Kalur: : www.vk.com/id220182215.
  • Lil\\' Kardinall: : , : lil.kardinall@gmail.ru
  • : 1917 .., . - -11 - ..
  • : 19.08.1974 .., : , ., . 78 , 3
  • : 11.02.2003 .., : , .5 .1
  • : 04.04.2003 .., : , .42 .1
  • ( .): 23.09.1965 ..
  • : 20.4 .., - - .., .: 89046340***, : , : www.ok.ru+ , : - , id : 73671049, : , , ,
  • : 15.12.1992 .., : Love my baby, - .., : , !!!, : www.ok.ru+ , : Russia, Comedy Club.., id : 73516394, : , !!!,
  • : , .12 . : : , : 09.02.1994, : 2, :
  • Rt Rt: : www.ok.ru+Rt Rt, id : 73609936,
  • : - .., : www.vk.com/id146895344.
  • Openhaarden Centrum: .: 715720536, : , , 2321HS, Leiden, Lammenschansweg, 141/B.
  • : 1962 .., : 26. :
  • : NISSAN ATLAS, (), , , , 14725, 1989 .., : , :
  • : 00.00.1918 .., : . - .6
  • Tulemetova Sadokat: : www.vk.com/id220718229.
  • : 1957 .., : 10. :
  • "" (""): .: 28.07.2011 ., : 7826111998, : 1027810266637, : 783901001, : 40262566000, : .2 .21.1 08.08.2001 129-, : 198020, - , , 28.
  • : 18.03.1925 .., : , 196
  • ò : : 2863621179, 27.05.1978 .., - .., : ,
  • : : www.vk.com/id220340349.
  • : 26.05.1986 .., . , . .7
  • : 29.02.1960 .., , , - .., : 5
  • ò Ͳ: : 3154914076, 18.05.1986 .., - .., : ,
  • : : www.vk.com/id146804333.
  • : 6.2.1996 .., : (. ), : ]{@RaMeJIb]{o_O, : SimS _! , _ - .., : ? !!!, : ), : www.ok.ru+ , : ?, : hillary daff, maksim katy parry, , , centr!!!boombox P.S. !!!! ..., id : 28060513, : ICQ!!!! .... ), : http://..
  • : 16.4.1986 .., - .., : www.ok.ru+ , id : 3189411,
  • : 19.04.1997 .., : , 3 , 30
  • "" - "": , : 840000 ., ./: 275-34-23, : - , : 7825117595, : 48997043, : , , , : 191028, 000000.
  • YIZHENG City MAJI Town QIUYING Primary school: : LIN,YONGSHENG, : education, : , 211414, Jiangsu, Yangzhou, QIUYING Village, MAJI Town.
  • : 5.8 .., : www.ok.ru+ , id : 3264468,
  • U43555@rambler.ru U43555@rambler.ru: : www.ok.ru+U43555@rambler.ru U43555@rambler.ru, id : 73246160,
  • : 01.08.1984 .., : ., , , .12 .3
  • : 19.12 .., .: 8917..........., : www.vk.com/id220817540.
  • "" - "": , : 850000 ., ./: 341-05-42, 341-05-42, : - , : 0, : 49992421, : , : 193036, 193036, 341-05-42.
  • : : www.ok.ru+ , id : 73605959,
  • : .: 8 9084494015, : , , 79
  • : 26.10.1963 .., . , . .3 .8
  • : 13.05.1998 .., : , - , - , 13.
  • : 01.01.1938 .., : 654086, , , ., . 34
  • : : www.vk.com/id221112770.
  • : : www.ok.ru+ , id : 73668208,
  • : 21.02.1957 .., , . . 59, . (495) 4059669.
  • : 29.07.1971 .., : ., , . , . , .12
  • : : www.vk.com/id146796072.
  • : 20.11 .., : www.ok.ru+ , id : 27978949, : (((.
  • 9611091658 PRE_PAY : .: 89611091658 (), : .
  • : - - .., : www.ok.ru+ , id : 3217506,
  • : 17.04.1948 .., : , .
  • : 01.11.1934 .., : , . . 4, .: (495) 9364262
  • : 01.01.1964 .., : ., --, , 9.
  • : 17.01.1962 .., : , , 10, .: 8 (3812) 227, : NISSN LS, 04255, 94_ ..
  • : 04.10.1947 .., : ., . - 11, .: 8 (812) 0065549, : -21120, 08747, 2001 .., : XTA21120020039325, 2112 0417707.
  • : : www.vk.com/id220852136.
  • : 20.7 .., : www.vk.com/id146817404.
  • : 23.10.1978 .., .: 9095956039 (), : , . . 14
  • Abuev Ah',mad: - .., : www.ok.ru+Abuev Ah',mad, id : 73396146,
  • : : www.ok.ru+ , id : 3212727,
  • : 10.08.1982 .., : , , , 31 : "-".
  • : 18.09.1957 .., : , . .20 .3
  • : 1.7.1999 .., : www.vk.com/id220958657.
  • : , . . 14 . 5 ,
  • : : , , 1 .
  • : 11.11.1911 .., : , - 5621687003, 0, 0, : , 2140, 2019, 1982 .., : 1212581, 975702.
  • : 22.05.1949 .., : - 1, , .
  • ˲ в : : 3190711414, 11.05.1987 .., - .., : ,
  • : 23.02.1927 .., : , . . 21, .: (495) 1152064
  • : 20.9.1972 .., - .., : marine.rud, : www.vk.com/id221205179.
  • : 03.09.1958 .., : "-", : ., .39
  • JINHU County XINNONG Town Villages and towns Enterprise Management Service station: : PAN,GUOGUANG, : supervise administrate service business, : , 211629, Jiangsu, Huaiyin, JIZHEN, XINNONG Town, .: (517) 6481222.
  • : : www.vk.com/id219989778.
  • : 24.10.1979 .., : , . .28 .1
  • : 13.8 .., : www.ok.ru+ , id : 73731071,
  • : 10.02.1969 .., : , : , , , 63
  • : : 1234408072, 18.10.1933 .., - .., : ,
  • 65 : .: +7 (495) 675-86-48, : , . 1- , 2/7, .2, : , , , , ,
  • : 15.9 .., : www.ok.ru+ , id : 73251065,
  • : : www.ok.ru+ , id : 73624404,
  • : : , . . 68 . . 68 . . 68, . (495) 1933454.
  • : 13.5.1984 .., : www.ok.ru+ , id : 73304183,
  • Kogabaeva Gulsezim: 29.6 .., : www.vk.com/id220776039.
  • ""): .: 26.11.2003 ., : 4101082938, : 1034100003387, : 410101001, : 30401000000, : , : 683024, , - , 50 -, 17/1.
  • Kerkhof C L M: .: 735211325, : , , 5244GZ, Rosmalen, Sparrenhoeven, 10.
  • Bird Free: 24.10.1992 .., : www.vk.com/id220499731.
  • : 2.4 .., .: 89520268064, : www.ok.ru+ , id : 73453726,
  • TAIZHOU JINTAI Chemical Co.,ltd.: : CHEN,YUJIN, : plasticizer, : , 225300, Jiangsu, Taizhou, ZHONGDUAN, WUZHOU Road, .: 551716.
  • Lopez Carbonell Lazaro: .: 8733054, : , SAN RAFAEL #1072 ,11 ,BJ e INFANTA ySAN FRANCISCO,,CENTRO HAB
  • : .: , : , , .........., : www.ok.ru+ , : 2, , : , , id : 73552433,
  • ..: , . . 7 ,
  • : : www.ok.ru+ , id : 73721121,
  • : : , : ..., - .., : , : , : www.ok.ru+ , : , : --, id : 73564771, : ,
  • : 23.10.1949 .., . , . .138
  • : 31.05.1965 .., : 21061, 80002, -, 1998 .., : XTA210610W4072584, 4072584, 5096815, : , , , 78.
  • : : www.ok.ru+ , id : 73860818,
  • : 05.04.1939 .., - - .., : , - "" . 81,
  • : 20.09.1962 .., : 2101, 68202, , 1971 .., : 0096858, 0099278, : , , , 33.
  • : 07.11.1958 .., : , , - -.
  • : 20.1.2000 .., - .., .: 380953047425, : www.vk.com/id220722729.
  • ..: : , ., 42, .: 8 (8442) 413348.
  • : 17.9.1998 .., : !, : !!!!!!!!!!, - .., : !!!, .: 8927......., : !!!, : www.ok.ru+ , : , , : , ., , id : 73696984, : , ,
  • : 15.1 .., : www.ok.ru+ , id : 27906688,
  • : 6.8.1965 .., : www.vk.com/id146507326.
  • : : www.ok.ru+ , id : 73320409,
  • : 05.07.1974 .., : 271501401, 88302, -, 1994 .., : 271500R0577573, 0577573, 0577573, 7337395, .: 65575, : , , , 11.
  • : 5.1.1994 .., : www.ok.ru+ , id : 73286590, : )).
  • : 08.01.1968 .., . , . .30
  • : : www.vk.com/id220306856.
  • : 23.01.1922 .., : ., . -, 76
  • : .: 89030258949 (), : ., 394000 . . 36
  • : 16.07.1978 .., . , , .16, .4.
  • : : ))), : , , - .., : , .: 0957089574, : , , 9 , : www.ok.ru+ , : ))), : , , , id : 73455519,
  • : 5.4 .., : www.ok.ru+ , id : 73529135, : http://ask.fm/zhukovamallla, http://instagram.com/zhukovamasha.
  • : 10.5.1991 .., .: +37533******, : www.ok.ru+ , id : 73104927, : ask.fm/denfreeman.
  • Raskolnikov Razumihin: 7.12.1983 .., : www.vk.com/id220526328.
  • : 16.3 .., : !!!, : [PROTOTYPE], Gas Koas, . - .., : , , - !, .: Samsung, : 1-2, , 2012, ..., : www.ok.ru+ , : 95, !, : .Ill Nino, Slipknot, Linkin Park, Nightwish, P.O.D., Arda. , !!!, id : 73287326, : , : !!!.
  • : 08.02.1964 .., : 443048, , , , 4- -, 11, : 322132, , -, 855163, 32213220243627, 32210020065693, 68559, 2002 ..
  • Ͳ : : 2480018035, 25.11.1967 .., - .., : ,
  • : 09.09.1981 .., : " " , : .,
  • "-900": : , .: 8 (383) 2923441.
  • : . .: 8 9601123328, : 397800, . , . , .12
  • : 20.07.1947 .., : , , 76.
  • : : www.vk.com/id221084583.
  • : 27.02.1975 .., : , . .10/12 .4
  • Bunga Laurenttika: 18.7.1990 .., Surabaya - .., .: +6283854331444, : laurenttika.bunga, : www.vk.com/id220741737.
  • : : www.vk.com/id220760681.
  • : - .., : www.vk.com/id220476585.
  • : : www.ok.ru+ , id : 73067840,
  • : 18.04.1927 .., : . -, -, ., 91, .: (812) 1788471.
  • : 30.5 .., : www.vk.com/id220617045.
  • WUXIAN City XINMIN Medical fittings Factory: : XU,QUANGEN, : silicone sebific duct, : , 215113, Jiangsu, Suzhou, SHIDONGSHAN Town, .: (512) 6281966.
  • : - .., : www.vk.com/id146803137.
  • : : , . , ., 40, .: 0/+380 (62) 952851.
  • YIXING City TAIHU Pearl Crafts Factory: : DAI,XINGYING, : pearl handicrafts processing, : , 214257, Jiangsu, Wuxi, No. 7, JIANKANG Road, FANDAO Town, .: (510) 7242618.
  • Asia Austine: 10.8 .., : www.vk.com/id220487343.
  • : 14.09.1974 .., : , , ., .
  • PEREZ BARREIRO MERCEDES: : 28037, Madrid, .: +34 913.064.611
  • Caroline Forbes: : gareeva.alina7@mail.ru
  • Dsfdsfds Dsfsdfdsf: .: dsdsfds, : www.ok.ru+Dsfdsfds Dsfsdfdsf, id : 73631236,
  • : 02.05.1976 .., : , ., 88. : , : , 88 74, .: 358312
  • : 8.9.1990 .., - .., .: 89203828857 8962725163, : www.vk.com/id146560427.
  • : 17.04.1949 .., : . .2
  • : : www.vk.com/id220230464.
  • : 26.04.1946 .., : ., - 36, .: 8 (812) 4351847, : BA2121, 437478, 1991 .., : XTA212100N0897517, 2121-2066893.
  • : 22.10.1930 .., : , . .7 .5
  • : 18.10.1960 .., . - ..
  • LIYANG City CHOU? Town Herding Veterinarian Station: : XU,YANXING, : poultry and livestock sickness . stimulate stockbreeding development ., : , 213324, Jiangsu, Changzhou, No. 33, WENMING XI Road, CHOU? Town.
  • : ..: 8 9178633305, : , . , . , . , , 423330
  • : : , ,,,,14,34, , ,,,,14,34, : " ",. 9 ,: 6
  • : 27.12.1983 .., : , 416, ., ., 15
  • Guven Ekrem: : www.vk.com/id220721339.
  • : : www.vk.com/id220183092.
  • Ͳ : : 1845521192, 12.07.1950 .., - .., : , в
  • : 11.10.1945 .., : , . . .21/19 .3
  • Way Milkey: : www.ok.ru+Way Milkey, id : 73573809,
  • : 27.2.1988 .., : www.ok.ru+ , id : 3120852, : -.
  • : 26.04.1932 .., : , . . 98, .: (495) 3365256
  • ò ˲: : 3130215016, 13.09.1985 .., в - .., : , в
  • : 4.7.2000 .., .: , : www.vk.com/id221037773.
  • : 30.01.1958 .., : 97491, , , ., , . , 9, ..
  • : 14.09.1962 .., : 446200, , , , , , 14, : 21043, , -, 54263 *, 2104300718407, 0718407, 5490456, 1999 ..
  • ò : : 2997622912, 26.01.1982 .., - .., : , '
  • : 18.4.1985 .., : www.vk.com/id220386715.
  • : : www.ok.ru+ , id : 73290880,
  • - : 22.04.1955 .., : , .. 8
  • : 28.12.1979 .., , . . 2 . 5, . (495) 1885088.
  • : : ., , , . 47, .: 8 (8172) 726666, : 2110, -21102, 19935, 2003 ..
  • : 17.09.1958 .., : , .
  • : 12.06.1976 .., : , . .41 .1
  • : .: 89144740757 (), : . (.), . . 38
  • : 25.05.1928 .., , . . 5 . 4, . (495) 3128996.
  • : 08.08.1955 .., , . . 3, . (495) 1490976.
  • : 5.4 .., : www.ok.ru+ , id : 73728399,
  • : 02.04.1962 .., : , .26
  • : .: 8 9025558763, : , , 48
  • : : www.vk.com/id220448622.
  • : 08.09.1905 .., , . . 17, . (495) 9188716.
  • : 1914 .., : ., , , , 138
  • Culfa Can: : www.vk.com/id220153066.
  • *_*: : , : sonka08@mail.ru
  • : : www.vk.com/id146677198.
  • Grace Miss: 1.1 .., : www.ok.ru+Grace Miss, id : 73831380,
  • : : www.ok.ru+ , id : 27993257,
  • - : 19.9.1966 .., - .., : , : www.ok.ru+- , : , id : 73405066, : ,
  • : 28.8 .., : , : , 2, - .., : , . 1989, .: , : , , : www.ok.ru+ , : 2, : , , id : 3252952, : , , , , , : .
  • : : www.vk.com/id220025272.
  • : 04.09.1944 .., , . . 13, . (495) 5565194.
  • : 11.3.1989 .., - .., : www.vk.com/id146757861.
  • : 15.05.1928 .., : 5301, 0245, , 1985 .., : 152, 2045903,
  • : : www.ok.ru+ , id : 27869447,
  • : 18.11 .., : www.ok.ru+ , id : 27825820, : web.ru.
  • : : www.vk.com/id220828227.
  • : 22.09.2001 .. : .
  • : : 3173810831, 23.11.1986 .., - .., : ,
  • : : ^^AVAKUM^^, : www.ok.ru+ , id : 28033890,
  • : 21.7.1984 .., : , , . (. ) , - .., : , , , , : hrgamma, : www.ok.ru+ , id : 3283423,
  • : 5.4.1995 .., : www.vk.com/id146711194.
  • ² ² : : 1470316499, 03.04.1940 .., в - .., : , в
  • : 20.12.1991 .., : , . .28 .1
  • : .: 8 9243266694, : , ; , 23/2
  • : ²IJ ( ²IJ ), : , 77400 -ʲ, -, , . , .4, .: , 77400 -ʲ, -, , . , .4, .: ̲Ͳֲ, 476, 01.01.1990 ., : 1) 2551103002, в 2) 2709406108, ' в, : : 98300 ϲ : 75.12.0 i ii i, ..: 21663 ..: 21663.
  • : 01.11.1970 .., : , .
  • : : www.ok.ru+ , id : 3159277,
  • : 14.08.1965 .., : , , ( ).
  • : 05.01.1985 .., : , . .918
  • : : www.vk.com/id219999801.
  • : 25.01.1985 .., , . 92, . (495) 4642547.
  • : 30.03.1961 .., H . H - .., : , , 18.
  • : .: 8 (921) 9000502, 2786388, 2786388, : .. ., . 5
  • ..: , . . 139 ,
  • : : nikitarov@yandex.ru
  • : 4.2 .., : www.vk.com/id220889287.
  • : 01.02.46 .., : , , . , ., 12
  • : .: 89145001100 (), : . (.), 674600, , , 38
  • : , - . . . 6/8 . 3 ,
  • : : 3015622971, 25.07.1982 .., - .., : ,
  • Mendoza Joeriz: : www.vk.com/id220342115.
  • : : www.ok.ru+ , id : 73385380,
  • : 1951 .., : ., , , 1
  • : 17.11.1976 .., : , - 5625450100, , 61, : VOLKSWAGEN, TRANSPORT, 39457, 1986 .., : WV2ZZZ25ZGH027034.
  • : 03.03.1945 .., : , 1- . .6
  • : 01.04.1984 .., : , .123, : 21.09.2002
  • : 12.01.1940 .., : ., . -, 27
  • : : , , , 23
  • : 19.04.1918 .., : , 6- . .27
  • Ͳ : 01.02.1966 .., : , - 5922355100, ʲ, 37, : , 110207, 61972, 2003 .., : Y6D11020730381191.
  • 27.12.1992 ..: : ., . .5
  • Nazic Kest: : www.ok.ru+Nazic Kest, id : 73619847,
  • : .: 8 (921) 6456233, -, -
  • Jghjgh Jhj: .: hgh, : www.ok.ru+Jghjgh Jhj, id : 73568796,
  • : : www.vk.com/id220440015.
  • : 12.12.1953 .., : ., --, , 105.
  • : 01.01.1900 .., : , - 5920987401, ., ., : , 6114, 5033, 1985 .., : 077347, K115026.
  • : 21.05.1952 .., : ., . -, 7
  • : 05.08.1956 .., : .,..
  • : 18.03.1985 .., : 96012, , , ., ., 16.
  • Ghfsjs Gdafhgadh: : www.ok.ru+Ghfsjs Gdafhgadh, id : 73082271,
  • : 12.1 .., : elena.kazakova46, : www.vk.com/id221053284.
  • Cjnedchbec Hefyegfye: : www.ok.ru+Cjnedchbec Hefyegfye, id : 73718662,
  • : : . --> , : .
  • : 21.04.1983 .., : , , , 59
  • : 23.05.1918 .., : , .
  • : : www.ok.ru+ , id : 73258768,
  • : 01.01.1938 .., HH -H - .., : , , 12.
  • : 16.01.1981 .., : , . .118
  • : 20.7.1990 .., .: , : www.ok.ru+ , id : 73830063,
  • Instrumentacion y Componentes S.A.: : 28040, Madrid, .: +34 915.350.332
  • Bazeer N A M: : -, PF, 85 Station Rd Potuhere
  • : 13.9 .., - .., .: , : , : www.vk.com/id220703642.
  • Salvatore : : www.vk.com/id146756568.
  • : 28.3.1999 .., - .., : www.vk.com/id220727882.
  • : : , . .4 .2
  • ',: : www.ok.ru+ ',, id : 73581581,
  • : : polmp23@mail.ru
  • : 5.3.1971 .., : www.vk.com/id220852514.
  • : : www.ok.ru+ , id : 27749455,
  • : 01.01.1948 .., : , . .6 .4
  • : 30.08.1961 .., : . - . , : / 17 " " 5208003320, : , .
  • : .: +79184168503, +78613862409, : , 352389, , -, , .
  • : .: 89037456876 - US10 UK9 EUR44 cm28 RUS43 ( , Nike Pantheon, , , , : > : 43, : 2500 .), : , .
  • '' : : , - 5940300000, 0, : , 452, 2523Ѳ, 1982 .., : 111.
  • Berdanova Nazym: : www.vk.com/id146714457.
  • : : www.ok.ru+ , id : 73113479,
  • : : , , , . .10, , : 131, 04655, 1990 .., V11150.
  • , : , . , .
  • : : www.ok.ru+ , id : 28035404,
  • : : 3312507936, 10.09.1990 .., - .., : ,
  • : 28.08.1938 .., : , , ., -, ., ., 35, : SNI360, , 22663 *, VLUR420009032437, 9032437, 9032437, DS1202L015733032, 1998 ..
  • ? ?: 17.8.1987 .., : www.vk.com/id220955395.
  • : 13.08.1955 .., , . . 33 . 3, . (495) 9428622.
  • JIANGYAN City QIAOTOU Town Finance Institute: : XUE,CUNDE, : organize finance revenue . settlement finance pay . financing management . intendance, : , 225511, Jiangsu, Taizhou, Government YUAN, QIAOTOU Town.
  • : 4.10 .., - .., .: 8909-908-28-53, : artempro90, : www.vk.com/id220820385.
  • : 21.02.1950 .., : NISSAN PRIMERA, , 85552, SJNFBAP12U2297186, 2006 .., : , 1 .
  • : 16.11.1985 .., : www.vk.com/id221126186.
  • YIXING City DUSHAN LIDA Supply and marketing Company: : YANG,FAQIANG, : industry enterprise purchase & supply manufactory raw materials and auxiliary materials and promote sales tenement, : , 214251, Jiangsu, Wuxi, JIMEI Village, DUSHAN Town, .: (510) 7231404.
  • : 07.10.1979 - .., : , - , , , , 3, : 21099, , X533ANN, 1351865, 1993 ..
  • : 14.12.1969 .., : ,
  • : 29.03.1945 .., : ""
  • ˳ : : www.ok.ru+˳ , id : 28035326,
  • : 11.05.1957 .., : , . .10 .1
  • : .: 89265550269 - . . . ( , Emmaljunga Mondial Duo Combi 2 1, , : , : 17000 .), : , .
  • : : www.vk.com/id221008525.
  • : .: +79229583040, +78336522962, : , 612270, , -, , , 154
  • в в: : 2496820991, 11.05.1968 .., - .., : ,
  • ..: : -, . , .: 8 (8672) 779085.
  • : ..: 8 9061191409, : , 420000 . . . . 6
  • : 31.03.1974 .., : , ., .3.
  • : : www.ok.ru+ , id : 73120943, : .
  • : : 3379105752, 07.07.1992 .., - .., : ,
  • ..: , 2- . . 20 ,
  • : 08.08.1956 .., , . . 4 . 2, . (495) 4229579.
  • : 29.06.1956 .., : , . .2
  • : 01.06.1976 .., : .-16, , : " " 7695 7707083893, : , .
  • : 06.01.1986 .., : , , ( -).
  • : 26.05.1979 .., : ., . -, 10
  • Flex Ex: 24.6.1986 .., : www.ok.ru+Flex Ex, id : 27975038,
  • TAIXINHE ( Wuxi ) Real & estate Co.,ltd.: : WU,XING, : real & estate business, : , 214043, Jiangsu, Wuxi, No. 238, JIEFANG XI Road, .: (510) 2712449.
  • : 18.05.1948 .., : . -, -, ., 119, .: (812) 5671166.
  • : .: 8 9046229211, : , , , 92
  • Tuncer Tugrul: 18.2 .., : www.ok.ru+Tuncer Tugrul, id : 73322270, : Futbol, Tenis,
  • : - .., : www.vk.com/id221033685.
  • : : www.vk.com/id220226550.
  • : : ., .12 ., : 21213, 20664, 19 ..,
  • : 01.10.1973 .., : , , ., . ., 2. : " " , : , 22, .: 50217
  • : 412, (), , , , 2364, 1972 .., : , :
  • : .: 89145185281 (), : . (.), ,
  • : 07.08.1944 .., : , , ., -, ., ., 19, : 2105, , 67863 *, 210500L1132930, 1132930, 4843429, 1980 ..
  • : 16.05.1930 .., . , . .3 .1
  • : : www.ok.ru+ , id : 73859752,
  • : 04.02.1941 .., - .., : ., -: , ., , 10
  • ϲͲ : : 3159314918, 01.07.1986 .., - .., : ,
  • : 5.11 .., - .., .: 89506132935, : www.vk.com/id146667605.
  • : : 3646300391, 31.10.1999 .., - .., : ,
  • : .: , : www.ok.ru+ , id : 73778187, : .
  • : 09.12.1955 .., : / .
  • Hernandez Oscar: : www.vk.com/id220467136.
  • : 21.3.1982 .., - .., : www.ok.ru+ , id : 73696103,
  • : 17.6.1990 .., : www.vk.com/id146473416.
  • - : : www.vk.com/id221028101.
  • ò : : 2464721371, 25.06.1967 .., Ͳò - .., : , Ͳò
  • Axiri-Sensen Sevgimin-Evveli: 5.1 .., : www.vk.com/id220722479.
  • : - .., .: (495)951-29-51 , : www.ok.ru+ , id : 73571538, : . . . . . , : www.slavfond.ru.
  • : - .., : www.vk.com/id220342548.
  • : - .., : www.vk.com/id220510754.
  • : 08.09.1965 .., : , ., 60 , 82. : " "
  • ij: : www.ok.ru+ ij, id : 73446086,
  • Qurbanova Ulya: 30.6 .., : L>? >LOVE, : www.ok.ru+Qurbanova Ulya, id : 73088901,
  • ˲ : : 3079419879, 23.04.1984 .., ֲ - .., : , ֲ
  • : : www.ok.ru+ , id : 73733902,
  • ..: , . . 64 . 5 ,
  • : 07.05.1969 .., : ., .- - 89, : , 32278, 1989 .., : WVWZZZ31ZL010253, F130999.
  • : 10.03.1964 .., : , . . 28, .: (495) 4443445
  • : 21.6.1990 .., : ,, : www.ok.ru+ , id : 27974728,
  • : : www.vk.com/id220237314.
  • : 22.6.1995 .., : www.vk.com/id221118585.
  • : 12.7 .., : Fifa 10, NHL 09, cs, - .., : !!!!!!!!, .: LG, : , , - , !, : www.ok.ru+ , : , , ., : !=), , , -47, , id : 73345937, : , , , , ,
  • : 10011984 .., - .., : - .
  • Swan Bella: 4.4 .., - .., : www.ok.ru+Swan Bella, id : 73855702,
  • 175 : : www.ok.ru+175 , id : 73680729,
  • : : www.ok.ru+ , id : 73778221,
  • : 19.11.1965 .., : ., : "-" 5254001230, : , .
  • CHANGZHOU City Products Quality Intendance Examination Institute: : SHENG,WEIQUN, : plant manufactory products , market marketing goods supervise examination , quality products arbitration examination , new products put into production quality appraisal examination , products molar itment examination , take part in standard formulate , revise and relate standard test test and verify, : , 213001, Jiangsu, Changzhou, No. 30, LANLING Road, .: (519) 6643017.
  • : 17.7 .., - .., : www.ok.ru+ , id : 73753732,
  • : 14.08.1965 .., : , . .79
  • : : , ., 36, .: 9206517374, 80855287919.
  • : .: 0977......, : www.ok.ru+ , id : 73578661,
  • : .: +79609546207, +73853720064, : 659650, , , . , .
  • : .: +7 (925) 755-63-48, : , . , 38, .1, : , , , , ,
  • H : .: 54057, : , . , - .
  • Nantong KAIBAO Agriculture & byproducts Co.,ltd.: : ZHU,HONGBAO, : planting processing marketing turnip , mustard and processing marketing globefish, : , 226241, Jiangsu, Nantong, DONGHUANGSHAN Village, LUSI Town, .: (513) 411293.
  • Vc,h .jl,k, Lybtvc: : g, hg - .., .: fmk, : www.ok.ru+Vc,h .jl,k, Lybtvc, id : 73314745, : fm.
  • -: : www.vk.com/id220417327.
  • Suleymanova Leiyla: 19.11 .., : www.vk.com/id220321503.
  • : 6.5.1982 .., : www.vk.com/id146914535.
  • : 17.06.1946 .., : , : ., . .39
  • : 5.11.1981 .., : , ,, : , - - .., : : . . , : ! : , : www.ok.ru+ , : :-), id : 3165737, : . . : , , , . . ! ! ! , , , !, : vk.com/love_coaching vk.com/aibaib vk.com/pozvonochnik.
  • - : : www.vk.com/id220360127.
  • : 01.01.1942 .., : ., , , 10-.
  • : 04.02.1980 .., : , , , 5.
  • : 23.04.1997 .., : , . .1544
  • Ԫ ò: : 3152615453, 25.04.1986 .., - .., : ,
  • : 11.03.1951 .., . , . .6 .2
  • : : , . . 36, . (495) 3347252.
  • : : www.vk.com/id220179301.
  • : 12.04.1972 .., : , , 8- 55
  • : : www.vk.com/id220137689.
  • : 21.05.1956 .., : /
  • Queiroz Fernando: 17.3.1993 .., : www.vk.com/id220255050.
  • : : , : , - .., : , : , : www.ok.ru+ , : , : , id : 73214306, : ,
  • : 1960 .., : 51. :
  • : : 7699018192, 01.01.1937 .., ʲ - .., : , '
  • : 23.10.1960 .., : . -, -, ., 36, .: (812) 3179330.
  • : 08021948 .., : ., - .75, : 2103, 58964, 1974 ..,
  • : 14.11.1992 .., : www.ok.ru+ , : helen_eyre, id : 27831437,
  • , , : 2140, 1169349, 3629, 1982 ..
  • : : www.vk.com/id220473615.
  • Roncero Fernandez Felix: : 28820, Coslada, .: +34 916.718.995
  • : 06.04.1984 .., : ., --, , 96.
  • : 5.9.1988 .., : www.ok.ru+ , id : 73481095,
  • : .: 8 9092591516, : 214036 . . 120
  • : 09.03.1962 .., : ., . -, 29
  • : 25.11.1994 .., : , , , , , 33
  • : 5.8.1993 .., . . - .., : www.vk.com/id220182086.
  • GAOYOU City Environment Supervision Dept.: : FENG,RONGCHUN, : all city communalize muddy enterprises & organizations unit toll sullage, : , 225600, Jiangsu, Yangzhou, No. 29, KUILOU'ER Village, DIEYUAN Road, .: (514) 4614691.
  • : 23.7 .., : , ., : 2, , - .., : , : , : www.ok.ru+ , : , : , id : 73420019, : . , =), : .
  • Fdgdfg Gdfgdfg: : www.ok.ru+Fdgdfg Gdfgdfg, id : 73282448,
  • : 12.08.1983 .., :
  • : 17.07.1962 .., : , . .3
  • : 09.01.1998 .., : - , ., ., 93
  • Kurganov Manu: 5.6.1993 .., : www.vk.com/id220909599.
  • : 13.02.1972 .., : , - , , 1.
  • Rrr Www: : www.vk.com/id220057721.
  • : : www.vk.com/id220367684.
  • : 30.10.1952 .., : , . .56
  • : : (495) 2979729.
  • : .: 8 9036386925, : . . 50 1
  • : 9.4.1971 .., .: 9173889609, : www.vk.com/id146916574.
  • : 25.02.1929 .., : ., , ., , .4
  • : . .: 8 9601249381, : . , . , .12
  • Sabirov Tahir: : www.vk.com/id220512465.
  • : 18.02.1987 .., : ., , , .10
  • : 20.7 .., .: AIPONE 5 ., : www.vk.com/id220453338.
  • : : , . . 20, . (495) 4128421.
  • : 01.01.1923 .., : , . . 10 . 2, .: (495) 1628780
  • : 26.06.1984 .., , . . 69, . (495) 3522896.
  • Transport Overmeen VOF: .: 571273915, : , , 7391ZT, Twello, Nijverheidsstraat, 13.
  • : 16.8.1976 .., : www.ok.ru+ , id : 3102804,
  • : : www.vk.com/id220009775.
  • Palchikov Palchik: 27.2.1988 .., : www.vk.com/id221016551.
  • : 30.08.1988 .., : , , , 24/2
  • : : 5511, 6520, , 1987 .., : 268076, 061790, : , .
  • : 01.10.1935 .., : ,
  • Grg Ergergergr: : www.ok.ru+Grg Ergergergr, id : 73574731,
  • ²˲ : : 2582519699, 15.09.1970 .., в - .., : , в
  • : : , .: 6511933.
  • IJ в : : 2876619973, 04.10.1978 .., - .., : ,
  • : 08.11.1976 .., : , . .29 .1
  • : 29.09.1939 .., . , . .48 .2
  • ˸: : www.vk.com/id146881719.
  • : : 3666300617, 18.05.2000 .., ղ - .., : , ղ
  • : 26.04.1939 .., : ., . -, 11
  • Ibragimova Nargiza: : www.vk.com/id146543384.
  • : 12.04.1962 .., : - 8
  • Kulbak Fedor: : www.vk.com/id220242186.
  • : 26.01.1953 .., : , - , -, 8.
  • : 16.05.1953 .., : , . . 19, .: (495) 3230097
  • : : www.vk.com/id220954865.
  • : 09011985 .., - .., : - . . .7
  • : 07.04.1951 .., : , . . 33, .: (495) 3573978
  • : 14.04.1957 .., : , , , 21.
  • ..: , . . 42 ,
  • : 17.1.1991 .., : , ., : , - .., : , , , , .: , : . , : www.ok.ru+ , : 95 , : , , ., id : 73391836, : , , ,
  • ̲ : : 3162514539, 02.08.1986 .., в - .., : , в
  • в в: : 2751021953, 27.04.1975 .., ײ - .., : , ײ
  • : 12.04.1917 .., : , . . 24 . 2, .: (495) 3086971
  • Gabriel Pausch: - Rug-Metal Sp. z o.o. ., : ul. Szkolna 15, 47-220 Kedzierzyn-Kocle, Rug-Metal Sp. z o.o., : info@rugmetal.pl, http://www.rugmetal.pl, tel.: +48 (77) 405-10-28; fax: +48 (77) 488-66-64;, (77) 488-66-64, : , , , , , , , , , , , (), (), - (). - Rug Riello Sp. z o.o. ., : ul. Mokotowska 59, 00-542 Warszawa, Rug Riello Sp. z o.o., : tel.: +48 (22) 657-16-00; fax: +48 (22) 623-00-93;, (22) 623-00-93, : , , (), , , , , , - , , , , , .
  • ..: , . . 42/36 ,
  • Schornagel I L: .: 207708621, : , , 1015GL, Amsterdam, Driehoekstraat, 44.
  • : 27.05.62 ..,
  • : 09.10.1924 .., , . . 19 . 2, . (495) 1974482.
  • : : www.vk.com/id146930635.
  • : : , -
  • Sa',dullayev Nurbek: : www.vk.com/id146678775.
  • : : 152151 . . 62, .: 9066396297
  • : 25.11.1990 .., .: Samsung, : www.ok.ru+ , id : 27725731, : http://vkontakte.ru/app638461_27725731.
  • : 27.5 .., .: 89173267543, : www.vk.com/id146581239.
  • : : , . . 7, . (495) 4032429.
  • ˲ в : : 2223121916, 12.11.1960 .., - .., : ,
  • TAIZHOU City JIANGDONG Construction Engineering Unit: : WANG,MAXI, : construction engineering service , retail wholesale building material ., : , 225312, Jiangsu, Taizhou, SHILI Village, JIULONG Town, .: (523) 6266842.
  • : : www.vk.com/id220882802.
  • : ..: 8 9172806326, : , . , 93 , . , , 603024
  • : 11.2.1995 .., : www.vk.com/id220442104.
  • : 25.07.1975 .., . , . .15
  • : 30.06.1941 .., : ., . -, 8
  • : : www.vk.com/id221093670.
  • : 11.5 .., : www.ok.ru+ , id : 73168791,
  • Carter Jsharia: : www.vk.com/id220645040.
  • ..: , . . 28 . 3 ,
  • : : , 45, .: 8 (831) 427729
  • : : www.ok.ru+ , id : 73739606,
  • : 01.06.1971 .., : , . .20 .5
  • : : www.ok.ru+ , id : 73683221,
  • "" - "": , : 840000 ., ./: 327-34-30, 327-34-30, : - , : 0, : 50891889, : , , , : 196158, 196158, 327-34-30.
  • : .: 8 9038933382, : . , . , .25
  • : 3.9 .., .: ********712, : www.vk.com/id220895459.
  • }{ : : www.vk.com/id146739001.
  • : : www.vk.com/id220022143.
  • : : www.vk.com/id220314466.
  • : : www.ok.ru+ , id : 73342717,
  • "" 0 1037739098462: ./: 5046451, 0, : 391012, , , , , 10, 40.
  • : 09.05.89 .., : , , . , ., 19
  • : - .., : , , 2, , , ., : www.ok.ru+ , : , ))), id : 73553771, : ,
  • : : www.ok.ru+ , id : 73264633,
  • ò: : 3436001839, 27.01.1994 .., - .., : ,
  • : : www.vk.com/id221160827.
  • : : www.ok.ru+ , id : 27768065,
  • : 20.04.1964 .., : ., ., . , ., .92
  • I : .: +380952247673, : , . . . 31
  • Harris Oliver: : www.vk.com/id221149508.
  • Seralimova Diana: 6.5.1996 .., .: 87776089170, : www.vk.com/id220065139.
  • : : 2062023275, 15.06.1956 .., - .., : , IJ
  • : 14.9.1999 .., .: , : !?, : www.vk.com/id220764433.
  • : : www.vk.com/id146734400.
  • : 8.8 .., : www.vk.com/id146881268.
  • ..: .: 8 (3812) 216322, : , 21 24.
  • ""): .: 28.03.2013 ., : 5208001482, : 1035200827640, : 520801001, : 22217836001, : .2 .21.1 08.08.2001 129-, : 606162, , -, , , 3.
  • : 01.07.1927 - .., : , - , 19582343, , , 109, : 2, , 2864XB, ., 1971 ..
  • : 13.3.1992 .., : www.ok.ru+ , id : 73163041,
  • () : - .., : www.ok.ru+() , id : 73236455,
  • : : www.vk.com/id220723105.
  • : 1925 .., : , , 10.
  • : : www.vk.com/id220777361.
  • : : - 91/2-18
  • : : , 42.
  • : 30.07.1932 .., : ., , , .38
  • : . .: 8 9050427730, : . . 5
  • : .: +7 (916) 058-94-22, : , web-bear.ru, : , , , -,
  • Maxell Dj: 11.2 .., .: , : www.ok.ru+Maxell Dj, id : 73397282, : www.promodi.ru.
  • Topolnytska Nataliya: 17.7.1964 .., : www.vk.com/id220252862.
  • : 19.11.1985 .., : ., : "" 5259008768, : , .
  • : : www.ok.ru+ , id : 73870953,
  • : .: 8 9024840837, : , , 9
  • : .: 89262867411 - . , , . , , . , . ( , 24 Pb, , : , : 500 .), : , .
  • : : www.ok.ru+ , id : 73661687,
  • : : www.ok.ru+ , id : 28025190,
  • : 19.10.1973 .., : ., . -, 24
  • : .: 8 (812) 89216438406, .: 6438406 (Tele2)
  • : : , : www.ok.ru+ , id : 73177776,
  • : 10.04.1996 .., :
  • : 14.11.1989 .., : , .
  • YANCHENG City YUNLONG Industry Co.,ltd.: : WU,JINLONG, : garments , textiles manufactory , marketing , steels , wood , coal , building material, : , 224003, Jiangsu, Yancheng, SHANGZHU Park, Economy Development Zone, .: (515) 8280360.
  • -: : www.ok.ru+ -, id : 73343512,
  • Driver Hysteria: : www.vk.com/id146741898.
  • : 02.03.1957 .., : , , .(- -).
  • : 15.01.1976 .., : 21070, 61002, -, 1998 .., : T210700W1145153, 1145153, 5176730, : , , , 51.
  • : 03.12.1961 .., .., : 424000 . - . ., : 1200001885,
  • "" 0 1027722009248: ./: 9160093, 0, : 111020, , , 10, 1
  • в ˲: : 2472516971, 11.09.1967 .., - .., : ,
  • : : www.ok.ru+ , id : 73490014,
  • в ': : 3130715996, 18.09.1985 .., .ȯ - .., : , .ȯ
  • Cristiano Ronaldo: : www.vk.com/id220300608.
  • Dashok Dashok: 19.4.2000 .., : www.vk.com/id220697674.
  • Stein Frankie: 1.9.1999 .., Salem - .., : www.vk.com/id221155793.
  • Kajjsasl Leonum: : www.ok.ru+Kajjsasl Leonum, id : 27992647, : + v - ? T My Stats v : - v Tv , , - T . - Visa, MasterCard , v𦪸 . T $10 ( ), Tv , cashout T T ( ). v .<,(^_^)>,,
  • : , . . 29 ,
  • A: : ., 3 (), - , 1991 .., : , : 7779, 9385, 0864, /K, :
  • Ҳ ò ò: : 3060220419, 14.10.1983 .., .ȯ - .., : , .ȯ
  • : 11.03.1992 .., : , . .41/2
  • : - .., : www.vk.com/id220410012.
  • : . , 105023, , 9-, .2, .2.
  • : 10.3.1986 .., - .., : www.ok.ru+ , id : 3146121,
  • : : . .: 212641.
  • : 11.09.1983 .., : (.: 05.04.84 .H) 47 , .
  • : 19.12.1968 .., : , , , 86.
  • : : www.ok.ru+ , id : 73550324,
  • ..: : , . 32, .: 8 (3452) 220045.
  • Jiangsu SHIDAICHAO City Co.,ltd. Nantong HONGQIAO Store: : ZHANG,XIAOBING, : marketing food , general merchandises, : , 226005, Jiangsu, Nantong, No. 23, QINGNIAN XI Road, .: (513) 3540716.
  • : 17.4 .., : WarCraft, Need For Speed, Perfect World, Linearge, , GTA, , Rice of Nations, - .., : . , : , , 13 , , , , , : www.ok.ru+ , : Rammstein, Sistem of a down, ., Linking Park, , , id : 73269262,
  • : 23.08.1981 .., : , . . 10, .: (495) 2427965
  • : The Sofa Co, 5244, Shops & other Retail Outlets, Furniture - Retail, : , , Sundorne Retail Pk, Arlington Way, Shrewsbury, Shropshire, West Midlands, SY1 4YA, SY1 4YA, West Midlands, Shropshire, Shrewsbury, .: 441743461041, : Mrs A Headley (Manager)
  • : 29.5.1991 .., - .., : www.vk.com/id220311370.
  • : 01.01.1955 .., : , . . 38, .: (495) 4227371
  • : : www.vk.com/id220045206.
  • Teszner Andy: 1.1 .., : www.vk.com/id220989589.
  • Svet Galya: : www.ok.ru+Svet Galya, : , id : 73752046, : , , , , , ,
  • : 21.3 .., : www.ok.ru+ , id : 73382394,
  • : 08.02.1957 .., : , 432, , ., 7. : "" , : .101, .: 327450
  • : 25.06.1961 .., : 2102, 46502, , 1984 .., : 2102000627407, 0627407, 7559526, : , , , 28.
  • : 18101961 .., - .., : . . .19 ..
  • ѲҲ : : 2534020395, 18.05.1969 .., ' - .., : , '
  • : 10.06.1964 .., : ., . -, 9
  • : 12.02.1952 .., : /
  • : 1950 .., : ., -, , , 28
  • : 16.05.1970 .., : . /
  • Sanchez Natalya: : www.vk.com/id221199254.
  • : 01.05.1956 .., : , .
  • : 05.11.1953 .., : , . .13/6 .1
  • : 22.12.1977 .., .: 891213674**, : sergei-7744, : www.ok.ru+ , id : 73751369,
  • - : : , . . 21
  • : 13.05.1974 .., : , , , 11, : 200, 970442, 1995 .., : WD2100351059599.
  • : : , . . . 2 . 2 ,
  • : , .479 . : : , : 12.07.1996, : 2, :
  • Broccoly Nastia: : www.ok.ru+Broccoly Nastia, id : 73533596,
  • : : , , , .49, , : 311211, 2766, 1988 .., 050686.
  • Tufgj Dfhcbry: getd - .., : www.ok.ru+Tufgj Dfhcbry, id : 73425432,
  • : : www.vk.com/id220424299.
  • : : , , , , 3-, : 21043-20, 2433, 2006 .., V1451B.
  • : : , . .21.
  • β ò ˲: : 3177011015, 25.12.1986 .., Ͳ - .., : , Ͳ
  • : 11.11.1911 .., : , - 5623050100, 1 , 28, : , 2101, 3082, 1971 .., : 0213102, 0213102.
  • : : , , 29.06.1940 .. .10
  • : , . . 4 ,
  • : : 3111717732, 12.03.1985 .., - .., : ,
  • : : www.ok.ru+ , id : 3062125,
  • Sunlight: .: 8 (800) 100-52-40, : , . , 1, , www.love-sl.ru, : , , , ,
  • : 11.07.1983 ..
  • : .: +79139460704, : www.vk.com/id220897203.
  • : 09.08.2002 .., : , .14
  • : 300857 .., : ., . .8, : 21213, 23264, 1996 .., : XTA212130T1206048.
  • : 18.11.1985 .., .: 9602970430 (), : , . , . , .108
  • ..: : , . . 11 ,
  • : 14.09.1949 .., , . . 42, . (495) 4391410.
  • : : www.vk.com/id220125306.
  • : 08.01.1950 .., : ., . -, 15
  • : 1.1 .., -- - .., : www.ok.ru+ , id : 27785070,
  • Ͳ Ͳ: : 2029820455, 29.07.1955 .., - .., : ,
  • : : , , , 2. : \, : 24.
  • Lianyungang HUANGHAI Automobile Revamp Service Co.,ltd.: : SONG,YUCHUN, : automobile repair service, : , 222000, Jiangsu, Lianyungang, No. 56, JIEFANG DONG Road, .: (518) 5455862.
  • : 11.08.1941 .., , . . 1, . (495) 2554910.
  • : : www.ok.ru+ , id : 73537749,
  • : : www.ok.ru+ , id : 73315547,
  • : : www.ok.ru+ , id : 73121896,
  • : 21.8.1978 .., : www.vk.com/id220440498.
  • : 20.10.1984 .., : , .
  • : : , , , , 4, : 408, 7444, 1973 .., 871067.
  • Wolberink J P M: .: 742773665, : , , 7559NE, Hengelo ov, Mechelenstraat, 9.
  • : 01.01.1900 .., : , - 5940100000, ., 1, : , 21412, 3424, 1992 .., : 0319903, 428670.
  • : 01.11.1930 .., , . . 1, . (495) 4485575.
  • : : www.vk.com/id220023205.
  • : , ʲ ' Ѳ' " ˲ֲ () "̲ IJ" ( ˲ֲ "̲ IJ"), .: , 29000 , , . , .22, .: ̲ ί ̲ί ί Ҳ, 16731020000004061, 07.11.2006 ., : 1) 33332218, ̲ , : : 88888 ֲ Ūֲί - IJҲ ²Ͳ : 85.31.0 i i .
  • : 23.04.1948 .., , . . 33, . (495) 3432715.
  • : 7.5 .., .: , : , : www.vk.com/id220751754.
  • "" - "": ,
  • : 08.10.1981 .., :
  • : 13.5.2000 .., - .., .: 0509233981, : www.vk.com/id220239674.
  • : .: +7 (495) 797-26-57, : , . , 21, @-www: 071903@mail.ru,, : , , ,
  • Yan Kane: : www.ok.ru+Yan Kane, id : 73645879,
  • : ISUZU GEMINI, (), , , , 257168, 1997 .., : , :
  • : 04.07.1946 .., : ,
  • : : www.vk.com/id220884301.
  • : : 3148215814, 12.03.1986 .., - .., : ,
  • : 10.08.1916 .., : , . .6
  • : 27.05.1973 .., : , . . . 10, .: (495) 1522974
  • ..: : , , .: 8 (3435) 2-38582.
  • : : www.ok.ru+ , id : 73139880,
  • : : www.ok.ru+ , id : 3105798,
  • Just-Do-It Nike: 1.1.1968 .., Oregon - .., : Nike,Inc, : www.vk.com/id220735755.
  • : 16.01.1955 .., : (), . , 47
  • : : www.ok.ru+ , id : 73474519,
  • : NISSAN ATLAS, (), , , , 73625, 1991 .., : , :
  • : .: --------, : www.ok.ru+ , id : 73291161, : -----------.
  • : : www.vk.com/id220330071.
  • "" - "": , .: 17.12.2002 ., : 0 ., ./: 6-24-02, 6-24-02, : - , : 0, : 43499576, : , , .., : 187400, 187400, 6-24-02.
  • : : ,,,,.,133,4 :,,,,.,133,4, .: 33-85-72 (), 8-927-23-13882 (), 25-40-17 (), 33-85-72, : " - ", . , . , . 17 (.: 25-40-17).
  • : : www.ok.ru+ , id : 73654171,
  • : 4.6.1970 .., - .., : www.vk.com/id220673828.
  • : 26.12.1987 .., : , 109
  • : : 610101539, 14.09.1916 .., в - .., : ,
  • : 00.00.1961 ..
  • : 29.10.1986 .., - .., : www.ok.ru+ , id : 73369265,
  • ò : : 3060219614, 14.10.1983 .., ˲ - .., : , ײ
  • : 15.04.1969 .., : , - , , 1.
  • Chaplinskaya Bogdanochka: : www.ok.ru+Chaplinskaya Bogdanochka, id : 27778804,
  • : 14.12.1986 .., _N+V+SIB____Novosibirskay oblast - .., .: , : , : www.vk.com/id221055032.
  • : . .: 8 9036382206, : 152240 .- . 2
  • Abo Jule: 22.10.1986 .., : www.ok.ru+Abo Jule, id : 73623492,
  • : 8.8 .., : www.ok.ru+ , id : 27789476,
  • : : , Karabash - .., .: 79511123184, : www.vk.com/id146850647.
  • HUAIYIN City Municiple Construct Engineering Head co.: : CHOU,TONGLIAN, : municiple road , road construct, : , 223001, Jiangsu, Huaiyin, No. 112, BEIJING BEI Road, .: (517) 3661814.
  • : 1970 .., : 86. :
  • : 08.04.1975 . .., .: +79108923299
  • : 17.5.1995 .., .: ........................, : www.ok.ru+ , id : 27941666, : fack.
  • Dz² : : 1165608774, 30.11.1931 .., - .., : ,
  • ² : : 1348314176, 30.11.1936 .., - .., : , в
  • : 03.10.1991 .., : , . .9 .3
  • : 23.03.1968 .., : ,
  • : 31.7.1986 .., - .., : www.vk.com/id220832375.
  • : 6.1 .., : www.vk.com/id220011792.
  • : 30.04.1966 .., : , . .12
  • Sdfgsdg Sadfsa10: : www.ok.ru+Sdfgsdg Sadfsa10, id : 73662145,
  • 04.06.1971 ..: : ., . .40
  • : 22.09.1956 .., , . . 16 . 2, . (495) 3606298.
  • Manapova Dilziba: : Alhamdulillyah! , : ??~zibo~??, Almaty city - .., : , : www.ok.ru+Manapova Dilziba, : ! ! , !, id : 3207906, : chinese, !,
  • : The CIM Centre: : Head Office, : 1990 ., : Kilkenny Road Inst of Technology Carlow Carlow, Inst of Technology Carlow Kilkenny Road Carlow Ireland, : 353599170426, cim@itcarlow.ie, http://www.cit.itcarlow.ie, : Manufacturers, Services : 4.
  • : HONDA PRELUDE, (), , , , 93725, 1997 .., : , :
  • : 29.3.1993 .., : www.ok.ru+ , id : 28038990,
  • : 01.01.1948 .., : , , 43.
  • I: .: 80332750391, 80332770000, : , . 52,12
  • : : www.ok.ru+ , id : 73597555,
  • : 01.02.55 .., : , , . , ., 15. : , 455043, . , 114
  • Sergeevna Ekaterina: : www.vk.com/id146502510.
  • 24.12.1982 ..: : ., .. .10
  • : : www.vk.com/id220319139.
  • : : www.ok.ru+ , id : 73446918,
  • : .: 8 9145675770 - , : ., 675000 . 25
  • 89098: : 8768658@mail.ru
  • : 08.08.1985 .., : . : , 85.
  • : : , : www.ok.ru+ , id : 73225212,
  • : 22.01.1988 .., : ., . -, 21
  • Fsdfsdfsf Dsfdsfsd: : www.ok.ru+Fsdfsdfsf Dsfdsfsd, id : 73084915,
  • Ramos Labrada Albertina: .: 32265441, : , Lenin, Calzada A Edif. DESA 3 Lenin
  • Barkan Onur Burak: : www.vk.com/id220156223.
  • : 23.10.1961 .., : , - 5640900000, ., ., : , 5320, 02981, 1982 .., : 0, 5320133924.
  • Basya Dimon: : , : , : , : , : www.ok.ru+Basya Dimon, : , : , id : 73269836, : ,
  • : 15.3 .., - .., : www.vk.com/id220511309.
  • 2838669: .: 8 9502838669, : , , 18
  • : : www.ok.ru+ , id : 3131122,
  • : : www.vk.com/id221116894.
  • ..: , . . 35 . 4 ,
  • : 29.05.1937 .., : , . . 3, .: (495) 2366274
  • : 08.05.1927 .., : , . .14
  • : 21.02.1972 .., : . / .
  • Khabibullina : : www.ok.ru+Khabibullina , id : 3108452,
  • : 24.07.1985 .., . , .26
  • ²IJ ί βֲ : : , - 5940136600, 0, : , 21099, 0061̲, 1999 .., : XTA210990X2578062.
  • : 2.8 .., - .., .: 89034663987, : www.vk.com/id220431744.
  • : 18.11.1937 .., : , . . 123
  • 04.12.1963 ..: : ., . .2
  • : SUBARU LEGACY LANCASTER, , , , , 258364, 1998 .., : , :
  • : 14.12.1941 .., . - .., : . 18
  • : 15.7.1980 .., : www.ok.ru+ , id : 73405545,
  • : 16.2.1987 .., : , , . - : . . () , : Zvezda, : Candy Mania, - .., : , , , : , , , , , : www.ok.ru+ , : Comedy club, : , id : 3173625, : - . , : .
  • : . , . . .16 .7
  • Fedotov Fedot: : www.vk.com/id221019526.
  • : .: 89144401735 (), : . (.), ,
  • : 08.05.1957 .., : , 14
  • : 1.12 .., : www.ok.ru+ , id : 27786041,
  • : 15.04.1964 .., : , . . 21, .: (495) 4595544
  • Ssss Sss: : www.ok.ru+Ssss Sss, id : 73358841,
  • : 03.08.1940 .., : 8119, 836602, , 1989 .., : 8909307, 9383, : , , , 6.
  • : 21.09.1928 .., : 21063, 4628, -, 1989 .., : 2343026, 1108700, : , .
  • : : ., .9
  • : 4.3.1998 .., - .., : www.vk.com/id220937246.
  • ..: , . . 63 ,
  • Sadgfadsg Afazfzsdgv: : www.ok.ru+Sadgfadsg Afazfzsdgv, id : 73326008,
  • : 30.05.1949 .., : , .
  • Nazaretyan David: 27.6.1997 .., .: +37477665215, : D3sonat, : www.vk.com/id221082693.
  • : : www.vk.com/id146498167.
  • : 05.02.1942 .., : ., . -, 3
  • : 09.06.1979 .., : / .
  • " ": .: 8 9242860093, : , ; , 103
  • : : www.vk.com/id220954227.
  • : 16.11.1960 .., : 21083, 18702, , 1994 .., : 210830R1529735, 1529735, 1544530, .: 36535, : , , , 20.
  • : 9.9 .., - .., : b.d_forever, : www.vk.com/id220961627.
  • : 26.11.1953 .., : ., , , .11
  • : 13.05.1974 .., : , , - , 42.
  • : .: 8-914-4**-5*-*9, : www.ok.ru+ , id : 73796532,
  • ? : 10.6 .., - .., : www.vk.com/id220714597.
  • : : www.ok.ru+ , id : 73426351,
  • : : , . .29 .1
  • Kelin Paul: 14.4 .., : www.ok.ru+Kelin Paul, id : 28028109, : Alneda.com.
  • : : ., .- - 18, : 21251, 8108, 1986 .., : 5193107.
  • : 09.09.1970 .., : , , , 75. : (), : 35.
  • : 15.7.1985 .., - .., : www.ok.ru+ , id : 73310813,
  • Dzmitry Botov: : biker19_94@mail.ru
  • : : 3143713216, 26.01.1986 .., - .., : ,
  • : 04.12.1989 .., : . ., : , .
  • : : www.ok.ru+ , id : 27724221,
  • : : .-,
  • "" - "": , .: 04.01.2003 ., : 840000 ., ./: 328-53-27, : - , : 7801117275, : 50028630, : , : 199178, 000000.
  • Daf Max: : www.ok.ru+Daf Max, id : 73122935,
  • : : www.vk.com/id220935235.
  • : : , . . 9, . (495) 1435761.
  • X X: : www.vk.com/id146874179.
  • : .: sdfghjkl, : www.ok.ru+ , id : 73831141, : 3456789.
  • : .: 87017770707, : www.vk.com/id146934244.
  • : : , , 1 . 2, .: 8 (7212) 456008.
  • ˸: 30.11.1993 .., - .., : www.ok.ru+ ˸, id : 3135962,
  • : 31.03.1980 .., : , , .( -).
  • : 20.05.1992 .., : ., --, , 124/6.
  • "" - "": , .: 05.12.2002 ., : 1000000 ., ./: 27-32-98, 27-32-98, : - , : 4826024517, : 48828122, : - , : 398002, 398002, 27-32-98.
  • : : www.ok.ru+ , id : 27941969,
  • : : www.vk.com/id220017872.
  • : : www.vk.com/id146643213.
  • : : 2- . 29, .: 8 (383) 3410366.
  • : .: 89145044560 (), : . (.), -. . . 18
  • Slucki Sergei: - .., : www.ok.ru+Slucki Sergei, id : 73071730,
  • ò: : 3426302293, 22.10.1993 .., - .., : ,
  • : : www.vk.com/id221166663.
  • : : olechka_256, : www.vk.com/id146885201.
  • : .: 8 9024836712, : , , 31
  • : 19.07.1979 .., . - .., : . 10
  • : 17.02.1959 .., : . -, -, ., 36, .: (812) 2226441.
  • : : www.ok.ru+ , id : 73590665,
  • : 24.7 .., : www.ok.ru+ , id : 27862505,
  • Humanes Lopez Antonio: : 28031, Madrid, .: +34 913.319.095
  • : 28.10.1953 .., : , 5-1-.
  • : 17.4.1991 .., : www.vk.com/id146767218.
  • : 7.8.1988 .., : www.vk.com/id220845506.
  • : :
  • Milinchuk Sasha: : - , - .., : www.ok.ru+Milinchuk Sasha, id : 27926480,
  • : 03.05.1934 .., , . . 24, . (495) 3729832.
  • Iglesia Evangelica Bethel: .: 45892160, : , 10 # 1308 e 13 y 15Carlos Rojas
  • : : , - .., : , : , : www.ok.ru+ , : , : HMR, id : 73489356,
  • : - .., : www.vk.com/id220931621.
  • : .: 8 9065802766, : . . 48
  • : 25.8 .., Riga - .., : www.vk.com/id220493167.
  • : : 3151315898, 12.04.1986 .., ² - .., : , ²
  • : .: 80432689474, +380965692393, : , I, .I, . 3- , .18
  • : : www.ok.ru+ , id : 3117177,
  • : 07.12.1993 .., : , .
  • Sen Aliyevin: 2.8.1995 .., : www.vk.com/id221059099.
  • : 01051964 .., : ., . .15, : 21099, 643971, 1997 .., : XTA210990V2173097.
  • : 4.8.1994 .., : www.vk.com/id221117776.
  • : 05.01.1981 .., . , . .12 .2
  • : 18.11.1918 .., : , 1- . .2 .1
  • : : , . . 17, . (495) 4506071.
  • : 13.09.1949 .. : . :
  • : : ., ., - - .., : www.ok.ru+ , id : 73382697, : . , ,
  • : : www.ok.ru+ , id : 73482925,
  • Alkandari Kandarii: 28.12.1985 .., : www.vk.com/id220250326.
  • Nurlan Arailym: : www.vk.com/id221099745.
  • : : www.ok.ru+ , id : 3121140,
  • : 29.06.1923 .., : , . . 73, .: (495) 1334284
  • : 19051951 .., : ., - .31, : 21093, 16064, 2002 .., : XTA21093023188452.
  • : Tinsmith, 5241, Shops & other Retail Outlets, Fabric Shops, : , , A, 8 High Street, Ledbury, Herefordshire, West Midlands, HR8 1DS, HR8 1DS, West Midlands, Herefordshire, Ledbury, .: 441531632083, www.tinsmith.co.uk, : Mrs P Woods-Humphery (Proprietor)
  • : 10.10 .., : (), : www.ok.ru+ , id : 73862813,
  • : 8.10.1988 .., : www.ok.ru+ , id : 3268102,
  • : : www.vk.com/id221180253.
  • : 17.06.1963 .., : - 49, , . : .
  • : 20.05.1972 .., :
  • : Hanneuse - Fischer/J: : , 1170, Watermaal-Bosvoorde, Heiligenborre.172, .: 3226721482, : Other.
  • : 5.9.1976 .., - .., .: , : , : www.vk.com/id220637403.
  • : 16.05.1993 .., : , , , 10.
  • : 110640 .., : ., .122, : 2141, 5848, 1988 ..,
  • : 31.8.1991 .., : ZORGoff, : www.ok.ru+ , id : 3203505,
  • Phillips Paul: - .., : www.vk.com/id220997038.
  • : 25.10.1922 .., , . . 23 . 3, . (495) 1979193.
  • : 27.09.1994 .., : , . .7 .3
  • : : www.vk.com/id220450059.
  • : 03.06.1940 .., : , .30
  • : 07.02.1925 .., : ., . .. . 147.
  • : 00.00.1972 .., : . .7
  • ..: , . . 46 . 4 ,
  • ? ?: : www.vk.com/id219979705.
  • : 24101985 .., - .., : - . . .6
  • : 06.10.1949 .., : ., , . , .2
  • ֲ : : 3031319991, 29.12.1982 .., - .., : ,
  • : 01.01.1900 .,
  • : 28.01.1997 .., : , . .35 .1
  • : : , . .5 .5.
  • : 21061951 .., : ., .20, : 2103, 96464, 1981 ..,
  • : 19.03.1967 .., : , - ., , 7. : "-"
  • : : 1350218075, 19.12.1936 .., Ѳ - .., : ,
  • Ricki: : www.ok.ru+ Ricki, id : 3199462, : http://ricki11.nm.ru.
  • в : : 2275823637, 23.04.1962 .., Ѳ-ʲ - .., : , Ѳ-ʲ
  • Bugnon Laetitia: : www.vk.com/id219997125.
  • : : www.vk.com/id220002060.
  • : : www.vk.com/id221048425.
  • "" ( ""): .: 04.03.2013 ., : 7715764208, : 1097746385175, : 771501001, : 45280594000, : .2 .21.1 08.08.2001 129-, : 127642, , , 9.
  • : 01.01.1943 .., , . . 32 . 3, . (495) 4225075.
  • : : www.vk.com/id220803178.
  • ²˲ ò: : 2737518150, 13.12.1974 .., - .., : ,
  • : 7.5.1997 .., : www.vk.com/id220091050.
  • English Speak: .: 22 - 78 - 79, : www.vk.com/id220726122.
  • : .: 8 9089727703, : , , , 42
  • : 29.03.1947 .., : , , , ., 1 , 21
  • ..: : , , 111, .: 8 (3852) 249315.
  • ¸ : : www.vk.com/id146618009.
  • : - .., : , , : www.ok.ru+ , : , id : 73493721, : , , ,
  • : 10.7 .., : www.vk.com/id220556387.
  • : 25.03.1932 .., : ., . -, 14
  • "- -": ..: 8 9046719232, : , 420095 28
  • : 25.9.1998 .., .: MTC 6054892, : www.vk.com/id146549504.
  • Schoonmaakbedrijf AARION BV Facilitaire Diensten: .: 742673806, : , , 7622AV, Borne, Industriestraat, 8.
  • : 19.1.1958 .., - .., .: 89502730812, : www.vk.com/id220094030.
  • : : 2421420770, 18.04.1966 .., - .., : , ²
  • Carli B: .: 628233614, : , , 3315EC, Dordrecht, Aletta Jacobs-erf, 183.
  • : : missteri.bros@mail.ru
  • : 24.08.1967 .., : , . . .64
  • : .: 8 9084488668, : , , , 12
  • : : , ., - .., : www.ok.ru+ , id : 73121438, : ,
  • : 2.1 .., : www.ok.ru+ , id : 73590594,
  • : : www.vk.com/id220300492.
  • : : www.vk.com/id220686177.
  • : : , . .28
  • : ..: 8 9172251732, : , . , 21, . , . ,
  • : : |||___ ___|||, : www.ok.ru+ , id : 3264062,
  • : 02.01.1952 .., : 652803, , , ., . .2
  • : 11.06.1978 .., : ., --, , 5/6.
  • : .: 8 (3812) 571020, : , 50 , 12
  • : 19.4.1983 .., : www.vk.com/id146932396.
  • : 13.06.1982 .., : . .70
  • "-" - "-": , : 840000 ., ./: 310-56-12, 310-56-12, : - , : 0, : 50906119, : , ; , : 195271, 195271, 310-56-12.
  • : 30.4.1996 .., : www.vk.com/id220287240.
  • : 29.01.1950 .., : (), . , 4 41
  • : 20.4 .., : www.ok.ru+ , id : 73268942, : http://instagram.com/aprelskaya_elena.
  • : : www.ok.ru+ , id : 27930055,
  • : - .., : www.ok.ru+ , id : 73796633,
  • : 10.06.1964 .., : , 368978,-
  • : : www.ok.ru+ , id : 27987480,
  • : . .: 8 9066891160, : . . 1
  • : 21.09.1946 .., :
  • : 11.02.1977 .., : , - .10, . .10
  • : : www.vk.com/id221107061.
  • : 211258 .., : ., , : 21063, 5641, 1985 .., : XTA210630F1228862.
  • : ..: 8 9172240433, : , . , .22
  • : 26.03.1965 .., : ., .- . - 40, : 200, 81578, 2000 .., : WD2100481231240, 2041287.
  • 05.02.1978 ..: : ., . .8
  • : .: 8950.., : www.ok.ru+ , id : 73386766,
  • : 01.05.1931 .., : , . . 31, .: (495) 2417598
  • Asdsd Qweqe132: : www.ok.ru+Asdsd Qweqe132, id : 73629254,
  • : .: 0964645633, : , : www.vk.com/id221161637.
  • : . , - .12 .1
  • : ., .: 8 (3452) 512583.
  • : : www.ok.ru+ , id : 73776386,
  • : 1.3.1988 .., : www.ok.ru+ , id : 27825891,
  • : 27.4.2000 .., - .., .: +79818904722, : staledancer27, : www.vk.com/id146608338.
  • : 15.01.1938 .., : ., . -, 24
  • , : , . , .
  • : : www.vk.com/id220413599.
  • : : www.ok.ru+ , id : 73503193,
  • Ը : 15.10 .., : www.ok.ru+Ը , id : 73349284,
  • : .: 89265695641 - 1- , ( - 5 ). . - 10 . : . , . (, 1- , , 1- , : 5800000 .), : , .
  • : .: 8 9039420415, : 16
  • : 03.05.1937 .., : , . () . 4 . 2, .: (495) 3532413
  • : 1.5.1981 .., : www.vk.com/id220498408.
  • 24.05.1938 ..: : ., . . .9
  • : : www.vk.com/id146877488.
  • : . .: 8 9601299888, : 000000, . , . , .12
  • : : www.ok.ru+ , id : 73298429,
  • : 20.04.1973 .., : , .11
  • : 01.11.79 .., : , , 5.
  • : 21.08.1938 .., : , . . 25 . 3, .: (495) 4884088
  • : 15.05.1961 .., : ., .- . - 36, : OKCBAEHO, 31478, 1989 .., : WVWZZZ1GZKW717492, E HOMEPA.
  • Hggh Loki: .: , : www.ok.ru+Hggh Loki, id : 73267894, : .
  • : 19.02.1959 .., : --, 40 63
  • Ds Alex: : www.vk.com/id220575293.
  • : 24.10.1941 .., : , .
  • Qqqqqqqqqqq Qqqqq: .: qqqqqqqqqqq, : www.ok.ru+Qqqqqqqqqqq Qqqqq, id : 73169029, : qqqqqqqqqqqqq.
  • : : www.ok.ru+ , id : 73794632,
  • : : www.ok.ru+ , id : 3250605,
  • : 24.6.1991 .., : !!!!, : , , - .., : , .: 89625319419, : , : www.ok.ru+ , : , : , id : 73600442, : , , ,
  • : 25.04.1960 - .., : , 1917000, 1917402, , , 36, : 2705, , U444ARM, 11109 13 /, 1996 ..
  • : 29.8 .., : , , .: 80673652196, : Ivan29., : www.ok.ru+ , : , , , id : 73507390, : _____________________ __________________ _________________ ____________________________ ______________________ ______________________ _______________ _______________ _______________ ______________________ ______________________ ____________________________ _______________________ ________________________ ___________________________ ____________________ ____________________ ____________________ ____________________ ____________________ _______________________ ___________________ _________________ _____________________ ____________________ ____________________ __________________ __________________ __________________ ____________________ _____________________ _____________________ __________________ ____________________ _______________________,
  • : 11.7.1985 .., : ColdZer0 ? Mo, : www.ok.ru+ , id : 3118939,
  • : : , , 43, .: 8 (3843) 462783.
  • Altaefi Abdu: : www.vk.com/id221096388.
  • : 15.05.1957 .., : 21099, 07702, -, 2000 .., : 21099012815490, 2815490, 2939932, .: 66259, : , , , 39.
  • : .: 89144594354 (), : . (.), , , .68, .12
  • Bogdanovich Olga: : www.vk.com/id220459601.
  • : :
  • : 15.08.1940 .., : , , , 36
  • ˲IJ Ͳ: : 1743214391, 23.09.1947 .., - .., : ,
  • : : www.ok.ru+ , id : 73604726,
  • : 15.12.1925 .., : , . .12 .5
  • : : www.ok.ru+ , id : 3259736,
  • Tirado Gain: : www.vk.com/id220069371.
  • : - - .., : www.ok.ru+ , id : 73187348,
  • : 14.1.1999 .., - .., : www.vk.com/id146494525.
  • : 04.04.1963 .., . , . .46 .1
  • : : 1027739370438, " " 0 1027739370438
  • : : www.ok.ru+ , id : 73481470,
  • : 23.07.1983 .., . , . . .23/2
  • : 30.01.1968 .., : , . .19 .1
  • : 19.09.1935 .., : , -
  • : 10.10.1952 .., : ., .19
  • : : www.vk.com/id220201662.
  • : : www.ok.ru+ , id : 73392997,
  • : : : . 2- , 13/40, 407, 408, ., , 123022, . 2- , 13/40, 407, 408, ., , 123022, : 70957883184, info@avicon.ru, http://www.avicon.ru, : , : ., , .
  • : .: 8 (921) 9170767, 2481938, 2481938, : , 32
  • : 9.8.1982 .., : www.ok.ru+ , id : 27997579,
  • Rydtguhfjk Rfdxtghjmn: .: rrrrrrrrrrr, : www.ok.ru+Rydtguhfjk Rfdxtghjmn, id : 73092995, : rrrrrrrrrrrrrrrr.
  • : 02.01.1972 .., : , .
  • : 08.07.1960 .., , . . 29 . 2, . (495) 1627931.
  • : : 3168913193, 05.10.1986 .., - .., : ,
  • : 21.3 .., - .., : irinabelocon, : www.vk.com/id146892678.
  • ? ?: : www.vk.com/id220978679.
  • : 23.07.1981 .., : . , : "" 5245006665, : , .
  • : 13.06.1997 .., , . . 34, . (495) 1418832.
  • : 13.12.1929 .., . , . .17
  • : : www.vk.com/id220158434.
  • : : www.ok.ru+ , id : 73673015,
  • : 04.02.86 .., : , , -., .
  • : : www.vk.com/id220874518.
  • , , : 21013, 4580446, 9942, 1985 ..
  • : 28.03.1965 .., : , . . 9 . 2, .: (495) 1146681
  • : : www.vk.com/id221165481.
  • : 05.03.1978 .. : . : ""
  • : : "". .: 227112.
  • : 24.2.1983 .., - .., : www.ok.ru+ , id : 73670745,
  • : : www.vk.com/id220274328.
  • : : , . .6
  • : 14031988 .., - .., : - . . .27
  • Uchia Saske: : www.ok.ru+Uchia Saske, id : 73129760,
  • : 01.02.55 .., : , , ., 19. : "", 454080, - , 71,
  • : : www.vk.com/id220093570.
  • : 01.01.1973 .., - . - - - ..
  • Simonyan Gohar: : www.vk.com/id220815360.
  • "MOUNT INDUSTRIES LLP" - , : B3 3QR BIRMINGHAM SUTE 211 45 NEWHALL STREET CORNWALL, : "", : 123290, , 1-, .5, .7, : - 8(495)664-34-75, : , , ( 6 ): :41256-57600 .' , , , ( - UNIVERSAL S.P.A., CARIOCA
  • : 01.11.60 .., : , , -., .. : "", 457418,, ,
  • : 24.01.1938 .., : . -, -, ., 4, .: (812) 4305672.
  • : 10.11.1963 .., : , .
  • : 6.6.1987 .., .: 09687239**, : www.vk.com/id220944619.
  • : : www.ok.ru+ , id : 73821073,
  • : 20.3.1993 .., .: , : www.vk.com/id220853347.
  • Visscher A: .: 522254090, : , , 7941XA, Meppel, Noteboomstraat, 64.
  • : 09.02.1968 .,
  • : : , . .22 .3
  • : 17.3 .., : www.vk.com/id220111314.
  • : 13.11.1986 .., : , . .1462
  • ..: , . . 20 ,
  • : , . . 2 ,
  • : 19.01.1978 .., : . , : "" 5258046312, : , .
  • : : www.vk.com/id220466552.
  • : 3.4 .., : ^_^ RoK^_^, : _, The Best)))) - .., : ))), .: velkom, : , : www.ok.ru+ , : ROK, id : 73829683, : , , )))),
  • : 31.05.1966 .., : .,..
  • "" ( ""): .: 20.02.2013 ., : 6670020500, : 1026604962636, : 667001001, : 65401373000, : .2 .21.1 08.08.2001 129-, : 620033, , , , 10.
  • : 01.01.1962 .., : ., --, , 5.
  • : : www.vk.com/id221005308.
  • : : 3081421990, 13.05.1984 .., . - .., : ,
  • : 22.08.1978 .., : , .
  • : : . . 8, .: 8 (383) 3484272.
  • : 15.05.1974 .., : , .32
  • Keggler Williams: : www.vk.com/id220975031.
  • -: 11.04.1937 .., : , . . 18, .: (495) 2533407
  • : : www.vk.com/id220137715.
  • Borchova Sonya: : www.ok.ru+Borchova Sonya, id : 73847360,
  • : 22.2 .., : www.ok.ru+ , id : 73146045, : http://ask.fm/Sokorenko.
  • : : www.ok.ru+ , id : 27999920,
  • : Em. Meyers Eftf. A/S: : Head Office, : 1834 ., : DK 2650 Hammerholmen 39 I Hvidovre, Hammerholmen 39 I DK 2650 Hvidovre Denmark, : Michael Nielsen - Administration Manager, : 4536349500, meyers@erhvervsgulve.dk, http://www.meyers.dk, : Manufacturers : 20 : 500000 (DKK) : Danske Bank.
  • Castro Karla: : www.vk.com/id220162627.
  • : : www.ok.ru+ , id : 3179751,
  • ò : : 3023021736, 07.10.1982 .., - .., : ,
  • : .: 70302, : , . , .
  • : : www.ok.ru+ , id : 73673131,
  • : 30.03.1964 .., : , .26
  • 2822060: .: 8 9502822060, : , , 14
  • : 1963 .., : ., . -71.
  • : : www.vk.com/id220951594.
  • : 16.9.1986 .., - .., .: 89209770003, : www.ok.ru+ , id : 73691005, : , ,
  • : 21.08.1967 .., : , . .24 .3
  • -- : .: 050......64, : www.vk.com/id220373646.
  • : 18.12.1964 .., : ., .- - 20, .: 8 (812) 2683388, : TOOTAKAMP, 64078, 2003 .., : JTDBF38K100121909, 1MZ1516374.
  • : 13.08.1962 .., : , , ( -).
  • : 01.01.1900 .., : , - 5924186401, ., ., : , 53, 14753, 1972 .., : 0, BN.
  • Ryazanov Maxim: : www.vk.com/id146798074.
  • Krasnova Anny: 14.12 .., : www.ok.ru+Krasnova Anny, id : 73574800, : http://vkontakte.ru/id73574800.
  • : 08.01.1952 .., : ., . -, 12
  • : 02.02.1954 .., : 2104, 40602, , 1989 .., : 210400L0230398, 0230398, 0963314, : , , , 6.
  • : 5.3 .., .: 89871332361, : www.vk.com/id220731056.
  • : : , . 17,.2
  • : : 88888 88888888 888, : 77777 777777 7777, - .., : 6666666, .: 0935731403, : 4444, : www.ok.ru+ , : 55555, : 33333, id : 73577666, : 2222,
  • : 12.06.1969 .., : - , .-, ., 4
  • ²: : 2972422419, 19.05.1981 .., - .., : ,
  • : : www.vk.com/id146928558.
  • : : www.vk.com/id146759890.
  • : 21.08.1927 .., : ., , . , , .2
  • : 22.8.1999 .., - .., : www.vk.com/id221078831.
  • : 12.7 .., - - .., : www.vk.com/id220330357.
  • : 11.05.1926 .., : ., . -, 15
  • : 18.06.1975 .., : , .
  • : 01.12.1957 .., : , 428, ., 42
  • : : =))))))))))))))))))), : =))))))))))))))))))))))))))))))))))))))))))))), - .., : S.T.A.L.K.E.R, : , : www.ok.ru+ , : , : 50 =))))))))))))))))))))))))))))))))))))), id : 73455850, : ))))))))))))))))))))))))))))))))),
  • : 01.04.1970 .., . , . .40
  • : 23.7.1992 .., : T𸪹 . + , . = v , + ., : =), , , - .., : ... Cosmopolitan, Glamur... , , ... =), : , , ... . , , ...=), : www.ok.ru+ , : =), : RnB, hip-hop, House, Electro... , , =), id : 73870135, : , , =), , ...!!! , , ... , =) , , ! , , , ...=) -.... ...=) , , ...=) , , ...=),
  • : 9.7 .., : www.ok.ru+ , id : 73401109,
  • : 11.02.1921 .., : --, , 64
  • : 08.12.1938 .., : , . 21-32
  • : 14.03.1999 .., . , . .4
  • : : www.vk.com/id220589726.
  • : : www.vk.com/id220752762.
  • Novikova Ira: 1.2.1979 .., - .., : www.vk.com/id220588275.
  • Kamel Lilya: 28.1.1995 .., : www.vk.com/id220851748.
  • : : 3059221650, 04.10.1983 .., в - .., : , Ͳ
  • : 29.08.1953 .., : ., . -, 10
  • : : , , ., ., .30, .1,
  • : 07081978 .., : ., .49, : , 61764, 1999 .., : ULV3L31BDXA062887.
  • : : 3064921710, 30.11.1983 .., - .., : ,
  • : : , - .., : , : , : www.ok.ru+ , : , : г , id : 73082183,
  • : 11.01.1954 .., : , .
  • : : www.vk.com/id146731030.
  • : 17.07.2035 - .., : , 2717220, , 91056, 2002 .., : .173
  • Mkvdari Mkvdari: : www.ok.ru+Mkvdari Mkvdari, id : 73222945,
  • : 21.01.1938 .., : , . .34
  • : 1.2 .., - .., : www.vk.com/id146632069.
  • "" ( ""): .: 18.02.2013 ., : 7716670111, : 1107746695198, : 771601001, : 45280556000, : .2 .21.1 08.08.2001 129-, : 129344, , , 18.
  • : 22.02.1966 .., : , , , ., ., 1
  • : 03.07.1952 .. : . : - " "
  • : 30.1.1972 .., - .., : www.ok.ru+ , id : 73536554,
  • : 16.8.1988 .., : www.ok.ru+ , id : 3068502, : http://nema.ru.
  • : 25.02.1972 .., : ., ., , .68
  • Safaryan Gagik: 20.2 .., .: 8-937-357-51-83, : www.ok.ru+Safaryan Gagik, id : 73501206,
  • ( .): 30.05.1971 .., : - . , : - .,15
  • : 19.07.1985 .., . , ., .43
  • : 15.5.1991 .., : FIFA, - .., .: SAMSUNG, : , : dubstik9115, : www.ok.ru+ , : Dubstep, , , ... )), id : 73130982, : ,
  • : : www.ok.ru+ , id : 27943658,
  • : 01.01.1970 .., : , .
  • : 17.11.1985 .., : ??????????, : PS2, - .., : , .: 0952439--0, : , : www.ok.ru+ , : , : , id : 73269719,
  • : 22.09.1954 .., : 446452, , , , , , 34, : 21083, , , 51663 *, 210830S1726129, 1726129, , , 1748485, 1995 ..
  • : : www.vk.com/id221095197.
  • : .: 8 (3812) 303504, : , , 6
  • : 02.06.1981 .., : 446350, -, -, , - -, - , , 269, : 31514, , , 92563, 3151400036709, 0036709, 0037231, 0037231, 1104136, 2000 ..
  • : : www.ok.ru+ , id : 73803696,
  • : 08.09.1935 .., . , . .229
  • : .: 89050744843 (), : . . 2
  • : .: 8 (3432) 324078, : ., . , 620088, . , 4
  • : 28.07.1976 .., : , .
  • : . , 3- . 46,.3
  • : .: 8 (812) 1558540, .: 6366078 (Tele2)
  • : 07.03.1977 .., , . . 15, . (495) 3270707.
  • Nekrasova Natali: 24.8.1990 .., - .., : www.vk.com/id220268766.
  • ²˲: : 2958638879, 01.01.1981 .., - .., : ,
  • : 15.03.1992 .., : ,
  • : 1.5.1959 .., : www.vk.com/id146561389.
  • Asryan Ani: 5.9.1997 .., : www.vk.com/id220003504.
  • : : , : popazopa69@mail.ru
  • 02.12.1947 ..: : ., . .98
  • : : www.ok.ru+ , id : 73251618,
  • : 26.04.1966 .., : . , : "-" 5257104650, : , .
  • Safont Raul: : www.vk.com/id220465161.
  • : 17.7.1982 .., - .., : www.ok.ru+ , id : 3093061,
  • : 13.08.1948 .., : , .
  • Jr Kiril: : www.vk.com/id146800284.
  • : Hampshire Society, 9133, Office & Administration, Charities & Voluntary Organisations, : , , 41 Belmont Road, Southampton, Hampshire, South East, SO17 2GD, SO17 2GD, South East, Hampshire, Southampton, .: 442380554729, www.has.org.uk, : Mr Andrew Monaghan (Chief Executive)
  • : 28.09.1929 .., : , . . 42, .: (495) 4336756
  • : 05.04.1955 .., : ., . -, 4
  • : 01.02.25 .., : , , ., 1
  • : : www.ok.ru+ , id : 3194457,
  • Wilson John: : www.vk.com/id219996568.
  • : : www.vk.com/id220323488.
  • : 04.11.1931 .., : ., . -, 60
  • : 01.01.1958 .., : , , -, 31
  • : 13.11.1936 .., . , . .21
  • : 10081964 .., : ., .58, : , 10064, 1998 .., : TMBBG41U1W2484298.
  • : : www.ok.ru+ , id : 3192807,
  • : 19.11.1971 .. : . : -
  • : : 3017025213, 08.08.1982 .., в - .., : , в
  • : 20.10.1970 .., : ., , , 23/3.
  • Ghmghmghm Hmnghm: : www.ok.ru+Ghmghmghm Hmnghm, id : 73323798,
  • : 24.08.1995 .., : , . .25 .4
  • : 27.03.1965 .., : - , ., ., 16
  • : : www.ok.ru+ , id : 3201182,
  • : 17.11.1968 .., - .., : www.ok.ru+ , id : 27717350, : .
  • : 14.11.1921 .., : , . . 9, .: (495) 9380420
  • : 16.01.1957 .., : , ., .6, ..
  • Fsafa Feafads: : www.ok.ru+Fsafa Feafads, id : 73787250,
  • : . .: 8 9051582421, : 307170 . . 2 .3
  • : : (495) 3505694.
  • : 19.04.1970 .., : ., : " " 5262101083, : , .
  • : 14.7.1994 .., : Postal 1-2, . - .., : , .: 89171293213, : ...., : www.ok.ru+ , : , : , , id : 73213542, : , : .
  • : : www.vk.com/id220017055.
  • : 21.05.1990 .., : , . .12
  • : : www.vk.com/id220862059.
  • : : , : , - .., : , : www.ok.ru+ , : , id : 73689290, : ,
  • : 4.8.1986 .., : - , ., - .., : , , : www.ok.ru+ , id : 27976815,
  • : 28.01.1980 .., : , . . 13, .: (495) 1292559
  • : : www.vk.com/id146706774.
  • Kaskavita Kaka: : www.ok.ru+Kaskavita Kaka, id : 73173541,
  • : : www.vk.com/id220346522.
  • : 3.12 .., : www.ok.ru+ , id : 27776015,
  • Dwdwaadwadwa Dwadwadwa: : www.ok.ru+Dwdwaadwadwa Dwadwadwa, id : 73224047,
  • : 23.02.1976 .., : , , 113, : /, .: 8 (3812) 257741, 257741, : 2103, 57855, 80_ ..
  • "" - "": , : 834900 ., : - , : 0, : 50864483, : , : 191040, 000000.
  • ..: , . . 114 . 3 ,
  • : 6.5 .., : www.vk.com/id146934508.
  • : - .., : .. , : www.ok.ru+ , id : 73237036, : ,
  • Byliniak Sylwia: : www.vk.com/id220001081.
  • : 27.07.1949 .., : , . . 8, .: (495) 2693144
  • : 03.06.1955 .., : , . .11 .1
  • : 19.11.1992 .., : - , .
  • : 14.11.1996 .., : 08 09 10 , - .., : _, : , : www.ok.ru+ , : ..., : house, , tecktonik, electro house dj ., id : 73229685, : .,
  • : 13.03.1988 .., : , 11
  • : 12.06.1994 .., : , . . 100, .: (495) 9314489
  • Sakurazuka Kiyoshi: 15.5.1990 .., : www.vk.com/id220008782.
  • : 8.11.1964 .., : , , - .., : , , : www.ok.ru+ , : . , Sade, . , . , . , id : 3137833, : !!!,
  • Ͳ ˲ : : 2670221318, 08.02.1973 .., - .., : ,
  • : 14.05.1950 .., : ., ., 9 , .11/1
  • : 7.6 .., .: 0633573456, : www.vk.com/id220088870.
  • : 21.4.1964 .., : www.vk.com/id220688053.
  • : 12.05.1941 .., : , . . 80
  • : : www.ok.ru+ , id : 73267455,
  • Bes Bes: : www.ok.ru+Bes Bes, id : 73677339,
  • : .: 8 9242396472, : , ; , 22
  • : : www.vk.com/id221040654.
  • : 18081984 .., - .., : - . . .136
  • : 05.05.1980 .., : ,
  • : 1948 .., : ., , , , 54
  • ²˲ : : 3128916055, 31.08.1985 .., - .., : ,
  • : : , : www.ok.ru+ , id : 73731790,
  • : 16.3.1989 .., : (ĸ), : www.ok.ru+ , id : 28007435,
  • : 21.2 .., : www.ok.ru+ , id : 3104200, : www.proobzor.net.
  • : : www.vk.com/id146943230.
  • Eyvazov Arzuman: 21.3.1986 .., .: 0507764403, : arzuman eyvazov, : www.vk.com/id220450860.
  • : 18.12.1975 .., - .., .: 89046986114, : , : www.ok.ru+ , : , id : 73213310,
  • : : , , , . .54, , : 8270, 18773, 1989 .., V4250B.
  • : 3.7 .., - .., : , : www.ok.ru+ , : The Beatels FOREVER, id : 73147932, : ,
  • : 10.06.1953 ..
  • "-" 5003017379 1045000905146: ./: 0, 0, : 000000, , , 29
  • : 11.09.1982 .., : ., , . , ., .9
  • : .: 8 (921) 9544045, 9544045, 9544045, : -, 35
  • : .: +79117578126, +78136620900, : 187650, , -, ,
  • : : www.vk.com/id220037413.
  • : 18.10.2000 .., : , .6 .2
  • : 01.01.1937 .., : ., , , 47.
  • : 05.05.1932 .., : ., . -, 26
  • : 9.9 .., - .., .: 375299715111, : slava-nikitf-1974, : www.vk.com/id220287597.
  • : : www.vk.com/id220816529.
  • : : www.vk.com/id220293274.
  • : 14.01.1940 .., : 446200, , , , , , 36, : 31514, , , 591163, 0032304, 0582380, 0582380, 81163, 1996 ..
  • : 14.10.1988 .., - - - .., : www.vk.com/id220014036.
  • : : ., .6
  • : 22.01.1961 .., : 3112, 9194, , 1984 .., : 041193, : , .
  • : 06.08.1953 .., : , . .23 .1
  • : 25.12.1969 .., : /31853, : 21100 73993 1996 .., 211000U0001945
  • : : ., . -, 3
  • : 20.04.1946 .., : . -, -, ., 10
  • : : www.ok.ru+ , id : 27739280,
  • : 1961 .., : , , .
  • : : www.vk.com/id146622280.
  • : : - --> , : - .
  • Dfhfdb Dgfhdfb: : www.ok.ru+Dfhfdb Dgfhdfb, id : 73327503,
  • : - "". : , , 156. : 77-37-63, 77-37-63. : 10000 .
  • : 16.06.1945 .., : ., . -, 6
  • EMP.COMERCIALIZADORA DE MET.Y MADERA: .: 7970620, : , Guanabacoa, FABRICA # 10 ESQ.JESUS LOPEZ LUYANO
  • : : , . . 15 . . 15, . (495) 4268420.
  • : : www.ok.ru+ , id : 73113412,
  • : 26.12.1953 .., : www.vk.com/id146566457.
  • - "" ( ""): .: 05.02.2007 ., : 3731003958, : 1073702004936, : 370201001, : 24401000000, : .2 .21.1 08.08.2001 129-, : 153000, , , , 16.
  • : : www.ok.ru+ , id : 73856606, : ******* .
  • : 05.04.1972 .., : ., , . , , .3
  • : : www.vk.com/id220948775.
  • : 09.09.1960 .., : , , , 15
  • : : 3153116113, 30.04.1986 .., - .., : ,
  • WUJIANG City XINHONG Materials Co.,ltd.: : SHI,LIFANG, : wholesale purchasing and marketing by proxy : building material . coal . nonferrous metal (precious metal) . silk, : , 215200, Jiangsu, Suzhou, TAIPING QIAOTU, NANHUAN Road, SONGLING Town, .: 3413402.
  • : : www.vk.com/id220327302.
  • ""): .: 03.03.2003 ., : 2459006385, : 1032401730074, : 245901001, : 04440000000, : , : 662320, , -, , , 23.
  • : 03.10.1988 - .., --, - .., : , --, , 58
  • : : www.ok.ru+ , id : 73585437,
  • - : : www.ok.ru+- , id : 73577950,
  • : 03.10.1972 .., , . . 27, . (495) 3088254.
  • Tiranov Mihail: 8.6 .., : www.vk.com/id220927753.
  • Dementev Aleksand: 4.5.1977 .., - .., : www.vk.com/id221180533.
  • Nikaa Nik: : www.ok.ru+Nikaa Nik, id : 73832069,
  • : : www.ok.ru+ , id : 27961216,
  • : 28.1.1987 .., : www.vk.com/id220205279.
  • : 27.09.1973 .., : , 3- . . 18, .: (495) 2473191
  • : 23.11.1952 ..
  • : 5.3 .., : www.ok.ru+ , id : 73798024,
  • ϲ ² : : 2440119336, 22.10.1966 .., - .., : , IJ
  • : 15.10.1918 .., : ., . -, . 44
  • : 14.03.2005 .., : , , , 13
  • : : www.vk.com/id146881570.
  • : : www.vk.com/id220998734.
  • : .: 89069252464 (), : 650070 . . 23 .0
  • : 11.09.83 .., : , , ., 25. : , 454081,
  • : : www.vk.com/id220467337.
  • : 5.4 .., : www.vk.com/id220905135.
  • : .: 8-921-1267948 (), : ., . , . , , 10
  • : 26.09.1996 .., : , .
  • KRASNIK OXANAMRS: : --> SSH, : -.
  • Lambeets Sten: 14.11 .., Paris / Marseille - .., : www.vk.com/id220351220.
  • : 16.10.1965 .., : , , ., 20, : , 180177, 2007 .., : JF1GDDLF37G075853.
  • : 14.11 .., : www.ok.ru+ , id : 73082702,
  • : 21.06.1977 .., - ..
  • : 01.11.1958 .., : , , 43
  • Heerink R H: .: 505530314, : , , 9744DK, Groningen, Egbert Reitsmalaan, 11.
  • : : www.vk.com/id146494478.
  • Coolsaet Nils: 3.12.1994 .., : www.vk.com/id220384347.
  • : : , 109, .: 8 (383) 233394.
  • Ͳ: : 2915620215, 29.10.1979 .., Բ - .., : , Ҳ
  • : 26.06.1970 .., : ,
  • : 24.05.1957 .., : , . .11/3
  • : 20.6 .., : www.ok.ru+ , id : 73395393,
  • : 30.01.1960 .., . , . .43
  • : : 3057021738, 12.09.1983 .., Ͳ - .., : , .ȯ
  • : - " ". : , , 5. : 288-40-81, 288-40-81. : 840000 . - "". : 840000 . - "-". : 840000 . - "-". : , , 8, 1. : 840000 . - " ". : 840000 . - "". : 840000 . - "- ". : 900000 .
  • : : www.ok.ru+ , id : 73598291,
  • : : www.vk.com/id221160740.
  • : .: 89002221535 - , 10. 236 , , 25 , 2012, . 2014. , (, 5336 2005, , : , : 435000 .), :
  • : 25.01.1937 .., . , . .14 .2
  • : : www.ok.ru+ , id : 73468825,
  • : 07.07.1980 .., : , , , 106.
  • : 31.1 .., : www.ok.ru+ , id : 27789770,
  • Klining-profi: .: +7 (495) 669-15-03, : ., ., . , 7, @-www: kliningprof@mail.ru, www.klining-profi.ru, : , , , , , ,
  • : 04.01.1977 .., : , - -
  • Del-Barrio Ruben: 16.4.1988 .., : www.vk.com/id220786534.
  • Aigaliev Sako: : www.vk.com/id220980860.
  • : 05.12.1952 .., : ., , , .13
  • : : , . . 5 . 3, . (495) 4130266.
  • : .: 8 9146514239, : , , 46
  • : 9.9.1998 .., : www.vk.com/id146905074.
  • : 01.01.1982 .., : ., , _, 22.
  • : 30.04.2002 ..
  • " " - " ": , .: 14.10.2002 ., : 840000 ., ./: 186-67-77, : - , : 7805116610, : 48948116, : , : 198095, 000000.
  • : 17.04.2006 .., : , , , 88.
  • : 6.10 .., : www.vk.com/id146578622.
  • : 31.8 .., - .., : www.vk.com/id221069628.
  • : 30.6.1992 .., : Pretty Girl, : www.ok.ru+ , id : 27905909,
  • MAHADEV RATNA VASNANI TRADING (L.L.C) : : -, (), 51615, Dubai, : 97143537738, : Gifts Trading
  • : 4.10 .., - .., .: ?, : www.vk.com/id220433733.
  • : : www.vk.com/id220493121.
  • : : www.vk.com/id146659713.
  • ..: , . 94 . 3 ,
  • : 20.07.1939 .., : , , . , 51
  • : : www.ok.ru+ , id : 73170736,
  • : 28.07.1997 .., : , 453620
  • De-Maria David: : www.vk.com/id220223842.
  • : 30.06.1947 .., , . . 14, . (495) 4713746.
  • : .: 80473026391, +380931186430, : , 20901, C, ., -, . , .17
  • : 9.7.1997 .., : ......., : www.vk.com/id146546193.
  • : 16.07.1992 .., : , - ., .353210, 353210 .
  • : - .., .: +79*5-277-1*-*5, : ..., : www.vk.com/id146634094.
  • Vroome W: .: 570677936, : , , 7423CR, Deventer, Waterhoen, 48.
  • : .: 8 9146531101, : , . , 2488
  • : 4.11.1989 .., : Strelok, : www.ok.ru+ , id : 3267244, : .
  • : 16.08.1946 .., : --, - 70
  • - : 7.6.1955 .., - - .., : www.ok.ru+- , id : 27869972,
  • Diab Amoore: : www.vk.com/id220941371.
  • : 30.07.1979 .., , . . 14 . 3, . (495) 4702861.
  • Arcesov Anton: : www.ok.ru+Arcesov Anton, id : 73744873,
  • : 01.01.1900 .., : , - 5940100000, ., 4, : , 21099, 05815, 1995 .., : XTA210990S1630975.
  • : 13.10.1936 .., . - .., .: . ()
  • : .: 89145112622 (), : . (.), ,
  • Chkhaidze Nina: : www.vk.com/id219975300.
  • : 12.8.1987 .., : . ., - .., : ... .., : www.ok.ru+ , id : 27726828, : , , , , ,
  • : 25.11.1954 .., : , , , 6
  • : 23.4.1982 .., : , : , - .., : , .: 89140712837, : , : www.ok.ru+ , : , : , id : 73845563, : ,
  • : .: 8 (921) 6414056, 1014177, 1014177
  • : : www.vk.com/id220514062.
  • : : www.vk.com/id146502293.
  • Boy Sexy: : www.vk.com/id146684617.
  • : : www.ok.ru+ , id : 3163145,
  • ˲ : : 1748015453, 10.11.1947 .., Ҳ - .., : ,
  • : : www.ok.ru+ , id : 73073388,
  • : 23.09.1960 .., : 446200, , , , , , 20/24, : 21140, , - , 90063 *, 21140054067581, 4067581, 4231513, 2005 ..
  • : 2.5.1993 .., : ?---?, .: ............, : www.ok.ru+ , id : 27838641, : http://vkontakte.ru/app638461_27838641.
  • Sarayeva Lyubov: 4.1 .., - .., : www.ok.ru+Sarayeva Lyubov, id : 27738463,
  • : 23. 2.1956 .., : - 22. :
  • : 05.03.2000 .., : , 1- . . 2 . 3, .: (495) 2860446
  • : : www.ok.ru+ , id : 73200446,
  • : 8.11 .., : www.ok.ru+ , id : 73112056,
  • : 03.06.1978 .., : , . . 3, .: (495) 3284252
  • : 3.12.1989 .., - .., : alenka2624497, : www.vk.com/id146573013.
  • : .: 8 9242572830, : , ; , 11
  • : : www.vk.com/id220151163.
  • : 09.09.1954 .., - - .., : , - , ( : , - ).
  • : 15.1.1957 .., - .., : www.vk.com/id220011569.
  • : 14.09.1976 .., : , , , 3
  • : 15.10.1925 .., : , 3- . . 10, .: (495) 3670971
  • : 26.01.1996 .., : ., --, , 75.
  • : .: 8 9089677299, : , , , 66
  • : .: 8 9241250360, : , . (), 92
  • ".." (..): .: 04.03.2007 ., : 7718093300, : 5077746112450, : 771801050, : 45263552000, : .2 .21.1 08.08.2001 129-, : 107150, , , 9.
  • Pullman: .: 152516501, : , , 2627AT, Delft, Schieweg, 87.
  • : 24041959 .., : ., .8, : 374102, 45464, 2002 .., : XTT37410220028365.
  • : 26.02.1947 .., : , , -, 90
  • : 24.10 .., .: 87771302452, : www.vk.com/id221063746.
  • : : www.ok.ru+ , id : 73174564,
  • : 27.1.1971 .., - - .., : www.ok.ru+ , id : 73293893,
  • : 18.10.1974 .., : .
  • : 02.07.2004 .., : . , : , .
  • : 28.3.1994 .., : ..............................................., : , - .., : !!!, .: 7..........9, : , , , , : www.ok.ru+ , : ., : .., id : 73814519, : , : ...
  • : . .: 8 9059191805, : . . 8
  • : .: 8 9066237118, : . . 16
  • : 23.08.1991 .., : , , , 10.
  • : : www.vk.com/id220677796.
  • Montague Ben: - .., .: 89154954445, : www.ok.ru+Montague Ben, id : 73525959, : ,
  • : 04.03.1956 .., : ., ., ., ., .22
  • : 05.12.1963 .., : , , , ., 6. : , 680000,., : ,
  • : 23.07.1929 .., : , . , 83
  • : : www.vk.com/id220455841.
  • - : 23.1 .., : www.ok.ru+ - , id : 73561497, : *********.
  • : : www.vk.com/id146751093.
  • : .: 8 9025066340, : , , 15
  • Dallaqyan Nara: : www.vk.com/id220041030.
  • : 19.6 .., - .., : www.vk.com/id221026020.
  • : : www.ok.ru+ , id : 73352562,
  • : : TT T+T-+ =L+L=L+TT-, : , - .., : , : , : www.ok.ru+ , : , , : , id : 3110096, : ,
  • : 19.7 .., - .., .: , : www.vk.com/id146809461.
  • : 3.4 .., : www.ok.ru+ , id : 3252241,
  • : : www.ok.ru+ , id : 73191522,
  • : : www.ok.ru+ , id : 3067908,
  • : 04.04.1962 .., : 1600, : .,
  • - : : www.ok.ru+- , id : 73131134,
  • : 18.05.1967 .., : , . . 12, .: (495) 1154669
  • : .: +7 (926) 578-91-50, : , . , 9, : , , , , , , , ,
  • : 8.1 .., : LenaKostika-Lk, : www.ok.ru+ , id : 27775947,
  • : : 3119318591, 27.05.1985 .., - .., : ,
  • : 20.03.1947 .., : , .- 22
  • 27.12.1935 ..: : ., . .94
  • : .: 89258395686 - 4 , , , 3 (, 4 . (, ), , 4 ., 0-4 , (, ), : 1100000 .), :
  • I: .: 80414624487, 80414622244, +380961267558, : , I - .I .I,24
  • : 29.09.1932 .., : ., , . , , .17
  • : 29.04.1982 .., , . . 25, . (495) 3582726.
  • : 29.11.1996 .., : www.vk.com/id146903040.
  • : 31.08.1967 .., : , . 5
  • : 15.11.1953 .., , . . . 3, . (495) 5114542.
  • : 20.09.1995 .., : , .14 .1
  • : 25.02.1961 .., : ., .- . - 14, : 9000, 38178, 1992 .., : YS3D651N1009123, 407351.
  • : 04.01.1970 .., , . . 7 . 7, . (495) 4238527.
  • Ѳ : 05.08.1948 .., : , - 5624655300, , 36, : , 2106, 07496, 1986 .., : XTA210610G0672703.
  • : 14.09.1981 .., : , , .
  • : 12.02.1961 .., : , 7- . .28
  • () : : www.ok.ru+() , id : 73313070,
  • : .: 8 (812) 1788570, .: 9924082 (Tele2), : , -, . 42/1
  • : 01.01.26 .., : , , , 6.
  • : 27.12 .., : www.ok.ru+ , id : 3185763,
  • : 23.10.1981 .., : , . .43 .
  • : 01.01.1930 .., : ., , , 20.
  • : 02.12.1998 .., : , , .( -).
  • Morris B P: : -, HDL, 25/16 Maradana Watta Rd Hendala
  • : 29.06.1929 .., , . . 16 . 3, . (495) 3993158.
  • : .: +79876476754, +78442271167, : 400105, , ,
  • : 22.6.1998 .., - .., : www.vk.com/id221123119.
  • : 23.5 .., - .., : www.vk.com/id146639427.
  • : .: +79252541607, : www.vk.com/id146722779.
  • : .: 8 (812) 1012311, .: 9950783 (Tele2), : , -, . 15 .1
  • Alle Mohamed: : www.ok.ru+Alle Mohamed, id : 73361680,
  • : : www.ok.ru+ , id : 73392401,
  • : : . , .: 0675554433, : , : www.ok.ru+ , id : 73866859, : , : .
  • : : www.vk.com/id220516255.
  • Dangiriev Ramzan: : www.vk.com/id220064454.
  • : 10.06.1975 .., : 97140, , , -, ., ., 28.
  • : 17.12.1930 .., : , , , 29
  • : .: 8 4232559382, : , , 18
  • : , . . 53 . 3 ,
  • : 07.08.1945 .., . , . .6
  • : 14.05.1937 ..,
  • : : , 17.
  • ³: : www.ok.ru+ ³, id : 73631660,
  • : 06.07.1937 .., : , . . 7, .: (495) 3080918
  • : 22.7.1985 .., : , : www.ok.ru+ , : , : , id : 73378321,
  • : 10.06.1953 .., : , .. .6
  • Askerkhanov Rashid: 15.9.1980 .., : www.vk.com/id220456404.
  • : 14.1.1993 .., : www.ok.ru+ , id : 27732804,
  • : 5.7 .., .: 89814274666, : www.vk.com/id146553408.
  • : : --> , : - .
  • в ²˲: : 2382321075, 23.03.1965 .., IJ - .., : , в
  • : .: 8 9030377234, : . . 7 13
  • : 14.06.1995 .., : --, , 15
  • : : www.vk.com/id221176047.
  • : 19.03.1931 .., : , . .1 .10
  • : : www.ok.ru+ , id : 73746309,
  • : , , .: 8 (3473) 280845.
  • : 28.10.1946 .., : , . .12 .6
  • : 14.06.1955 .., , . . 33, . (495) 9635312.
  • : 01.01.1981 .., : , . .36
  • : 01.01.1900 .., : , - 5920650100, ., 75, : , 750, 1938Ѳ, 1961 .., : 0, 47014.
  • : .: 8 (812) 1414463, .: 9080663 (Tele2), : , -, 51
  • : : www.ok.ru+ , id : 73342226,
  • : 18.08.1986 .., : 21102, -, 935152, XTA21102010326070, 2001 .., : , 16
  • : 10.02.1959 .., . , . . .15
  • : :
  • : 6.6.1989 .., : www.vk.com/id146644408.
  • : 29.11.1955 .., : 21093, 19302, , 21083, 1995 .., : 210930S1624225, 1624225, 1644329, : , ., , 6.
  • : 06.01.1964 .., : , . . 18, .: (495) 2594463
  • ..: , . . 58 . 2 ,
  • : : 2206, 96502, , 40210L, 2000 .., : XTT220600V0039201, 0038576, 0039201, 0116708, : , , , 10.
  • Hamasaki Rio: 12.6.1991 .., .: 9053704091, : www.vk.com/id146556328.
  • : 02.08.1982 .., : .:; .:; .:; 17.:; : ; - "" -
  • : 19.12.1979 .., : ,
  • : 16.12 .., - .., : www.vk.com/id146682429.
  • : 5.1.1997 .., - .., .: 87022647538, : www.vk.com/id220035046.
  • : : www.ok.ru+ , id : 73574079,
  • : : www.ok.ru+ , id : 73681999,
  • : 16.03.1953 .., : . . 18
  • в : : 3132614837, 07.10.1985 .., ² - .., : , ²
  • : . , . .13/15
  • WUJIN City TANGZHUANG Electric power Metals electrical appliances Store: : WU,MINGSHI, : , 213125, Jiangsu, Changzhou, TANGZHUANG, .: (519) 3206054.
  • Hollander G A: .: 302448101, : , , 3611AE, Oud-Zuilen, Dorpsstraat, 24.
  • : .: 8 (812) 3023193, .: 9526660 (Tele2), : , , 161
  • : 24.11.1965 .., : 443010, , , , , 230, : 21011, , , 43463 *, 3475229, 4538856, 1980 ..
  • : 13.3 .., .: 89500427887, : www.ok.ru+ , id : 73685530,
  • : 20.03.1975 .., , . . 10, . (495) 3924303.
  • : : www.ok.ru+ , id : 27753548,
  • : : , 1907000, 1907232, , , 65, : 469, 6919 ..
  • ² : : 3064320356, 24.11.1983 .., - .., : ,
  • : 7.7.1989 .., : www.vk.com/id220625523.
  • : ²²Ͳ Բ " " ( Բ " "), : , 54036 , , . ʲ, .42 , .: , 45036 , , . ʲ, .42 , .: ̲ ί ̲ί , 15221020000010522, 26.09.2006 ., : 1) 2936801632, ʲ , : : 99999 , : 45.25.4 i, ..: 483332.
  • : 16061982 .., - .., : - . . .20 .3
  • : 05.11.1952 .., : ,
  • : 26.4.1957 .., : www.vk.com/id220970324.
  • : : www.vk.com/id220567760.
  • : : ., . , . , .11 ., .: 9052976550
  • : 11.12.1979 .., : , , , 20
  • Logunova Nina: 2.3.1977 .., : www.vk.com/id220336812.
  • : 20.9.1987 .., : www.ok.ru+ , id : 27846263,
  • : 5.8.1985 .., : zeron, : www.ok.ru+ , id : 3123037,
  • ò: : 3126417119, 06.08.1985 .., в - .., : , в
  • " " - " ": , : 1000000 ., ./: 275-57-63, 275-57-63, : - , : 0, : 50060007, : , , , : 191028, 191028, 275-57-63.
  • : Business Formations (UK) Ltd, 7411, Office & Administration, Company Registration Agents, : , , Office 2, 16 New Street, Stourport-on-Severn, Worcestershire, West Midlands, DY13 8UW, DY13 8UW, West Midlands, Worcestershire, Stourport-on-Severn, .: 441886812352, www.uk-business-formations.co.uk, : Mrs Jane Adey (Managing Director)
  • Ͳ ²˲: : 3454701537, 02.08.1994 .., ʲ - .., : , ʲ
  • : 10.11.1989 .., : ., ., ., .1
  • : 22.10.1989 .., : www.vk.com/id220803741.
  • : 28.09.1974 .., : , , , 121. : -24 .
  • : 11.10.1959 .. : . :
  • : 14.11 .., : www.ok.ru+ , id : 73679442, : http://ask.fm/DisarmMe.
  • Denjov Simba: : www.ok.ru+Denjov Simba, id : 73653038,
  • -: : , . . 16, . (495) 7313497.
  • : 4.9.1996 .., - .., .: =), : www.vk.com/id221198450.
  • : 24.02.1947 .., : , , , ., 26
  • : .: 1170490, : , , -. 1, .9
  • : 02.05.1967 .., : 131, 55302, , 130, 1985 .., : 632565, 600080, : , .
  • : : )))))))))))))), - .., : , .: 8903314...., : , : www.ok.ru+ , : , : , id : 73854380, : ......
  • BUNINA TATIANA: : --> , : -.
  • : : www.ok.ru+ , id : 73523090,
  • : : www.ok.ru+ , id : 73368253, : .
  • Ruiz Abraham: 15.11.1984 .., : www.vk.com/id220052146.
  • : - .., : www.vk.com/id220261803.
  • Kaa Asmaa: 1.11.1998 .., : www.vk.com/id220104332.
  • : , . . 81 ,
  • : 16.08.1928 .., : , . . 21, .: (495) 1140092
  • : 1963 .., : 415. :
  • : 28.05.1919 .., : , .4
  • : : www.vk.com/id221150097.
  • : : listqqq@mail.ru
  • : 29.12.1967 .., : , . . 14, .: (495) 2847606
  • : : 2068321453, 17.08.1956 .., Dz - .., : , Dz
  • : - .., : www.ok.ru+ , id : 73184221,
  • Gorshanov Nikolay: 4.7.1995 .., : www.vk.com/id220669827.
  • : 10.03.1937 .., : , - . . 3, .: (495) 2877509
  • ..: : . , .: 8 (3452) 373041.
  • YIXING City XUSHE LIUTIAN No. 1 Printing Factory: : PAN,SAIXIAN, : printing , processing, : , 214241, Jiangsu, Wuxi, LIUTIAN Village, XUSHE Town, .: (510) 760191.
  • : .: 8 4232420709, : , , 59
  • : : www.ok.ru+ , id : 73325897,
  • : .: 8 9601014256, : 000000 .1 . 18
  • : : www.ok.ru+ , id : 27904614,
  • : 08.12.1960 .., . , . .10
  • : 01.09.1962 .., : 652700, , , ., . 14
  • : - .., : www.ok.ru+ , id : 73659707,
  • : 13.07.1942 .., : , . .17 .1
  • : 03.07.1963 .., - .., : . 43
  • : 27.02.1942 .., , . . 21, . (495) 3088439.
  • : 25.1.1972 .., - .., .: +79379992, : -, : www.ok.ru+ , id : 73155280, : -.
  • : 03061948 .., - .., : - . . .12.
  • : : www.ok.ru+ , id : 73564544,
  • YANCHENG City City QUFEIXIANG Garments Co.,ltd.: : GAO,XIANG, : garments , material , textiles , metals electrical appliances, : , 224001, Jiangsu, Yancheng, No. 39, YUHONGXIANG, .: (515) 8303818.
  • : 20.7.1991 .., : www.ok.ru+ , id : 3151207,
  • : 31.12 .., : ????, : www.ok.ru+ , id : 73713633, : http://ask.fm/akintos.
  • : 04.01.1968 .., : , - .81
  • : 18.12.1944 .., - - .., : www.ok.ru+ , id : 73268853,
  • : 26.10.1992 .., - .., .: 8(916)963-81-52, : www.vk.com/id146503017.
  • : : , p . 8
  • : 17.01.1984 .., : , , , 42.
  • : .: 80619414477, +380972196125, : , 27
  • : .: 8 (921) 6527925, 4224116, 4224116
  • : TOYOTA HILUX SURF, (), , , , 31725, 1988 .., : , :
  • : : www.ok.ru+ , id : 28022536,
  • : .: +7 (499) 735-02-30, +7 (499) 735-23-32, +7 (499) 735-12-31, : , ., 1- -, 3, @-www: skb@radel.compnet.ru,, : , , , , , ,
  • : 16.05.1964 .., : - , ., ., 4
  • ²˲ : : 3658600898, 02.03.2000 .., - .., : ,
  • : 03.05.2005 .., : 665310, , , , , 50
  • : 15.05.1956 .., : ., , , .32
  • : 02.07.1959 .., : ., . -, 31
  • : 17.02.1980 .., : (), : ., .1
  • : 26.4.1999 .., - .., .: 89103513469, : www.vk.com/id220587415.
  • -: 07.08.80 .., : , , . , 14.
  • : .: 999, : www.vk.com/id220838527.
  • IJ : : 908508915, 15.11.1924 .., ˲ - .., : , ˲
  • JIANHU County CHAONENG Steels Sales department: : JI,SHAONENG, : steels , civilian building materials, : , 224700, Jiangsu, Yancheng, Silliness ZHAOSHANGCHANG, .: (515) 6211701-8331..
  • : 04.09.2008 .., : - , ., . , 27
  • : 10.05.1993 .., : , , 29.
  • : : www.vk.com/id220029316.
  • : : , 620072 . 7, .: 8 (343) 475773
  • () : 18.10.1968 .., - .., : , : www.ok.ru+() , : ., id : 73405280, : .
  • : 29.01.1978 .., : - , ., ., 11
  • : : www.vk.com/id220188002.
  • : : 2930821050, 29.03.1980 .., - .., : ,
  • Բ : : 3109415053, 17.02.1985 .., ʲ - .., : , ʲ
  • : 17.06.1986 .., : , 16- . .49 .1
  • : 23.11.1993 .., : www.vk.com/id221122891.
  • Yunus Sayed: : www.vk.com/id220945568.
  • ? : .: naebalovo, : www.ok.ru+? , id : 73769307, : naebalovo.
  • : : www.ok.ru+ , id : 73334204,
  • : .: ********, : www.ok.ru+ , id : 73093010,
  • : 10.09.1963 .., : 21061, 14002, , 1997 .., : 210610V3720561, 3720561, 4863990, : , ., , 31.
  • Verta Ledy: : www.vk.com/id220193100.
  • : : www.ok.ru+ , id : 73511644,
  • : 12.11.1957 .., .: (495) 2466727
  • -: 01.07.1967 .., - - - .., : , 43, ( : , 43).
  • : . , ., ., .10, .2.
  • : 14.10.1958 .., : , . .26
  • : : 2988618234, 28.10.1981 .., .ȯ - .., : , .ȯ
  • : 30.1.1986 .., - .., : www.ok.ru+ , id : 27937325,
  • Sffs Afsf: : www.ok.ru+Sffs Afsf, id : 73857635,
  • : 16.08.1937 .., : , , .
  • : : www.vk.com/id220958525.
  • : 17.08.1999 .., : , . . 12, .: (495) 7123467
  • : 12.12.1946 .., : ., . -, 5
  • ( .): 01.10.1930 .., -,.H- - .., : ,, , : -,.,.,.34
  • : 01.01.1924 .., : , . . 5, .: (495) 4237692
  • : - .., .: 89875857713, : www.vk.com/id220967052.
  • : : Lipadze@vk.com
  • : 25.12.1948 .., . - - ..
  • : 15.10.1961 .., , . . 45, . (495) 1176827.
  • : : 3082821653, 27.05.1984 .., Ͳ - .., : , Ͳ
  • Inter- sink: www: intersync.co.jp/, intersync.co.jp/, info@intersync.co.jp, .: 03-5364-6225, 03-5364-6225,03-5364-6226, 81353646225, 81353646225,81353646226, : Business and Economy/Shopping and Services/Computers/Software/Internet and Networking/
  • : 3.11211, (), , , -1, 3487, 1985 .., : , :
  • : 01.01.1969 .., : ., --, , 1.
  • в Ѳ: : 2346122590, 26.03.1964 .., - .., : , .ȯ
  • : 30.01.1960 .., : - , : , , , 22
  • : : 1132371774, 01.01.1931 .., - .., : ,
  • : : www.ok.ru+ , id : 3236983,
  • : : , : , : , : , : www.ok.ru+ , : , : , id : 73740847, : - ,
  • : 2.1 .., : ))))? , , : , , , .?, : Lyki, : _), - .., : , : +_), : www.ok.ru+ , : , : Clab), id : 73566921, : ___________.
  • : 10.8 .., : www.vk.com/id220402850.
  • : : www.ok.ru+ , id : 27704596,
  • : 01.10.1973 .., : ., . -, 20
  • : 28.07.1955 .., : ., , , .2
  • : 21.03.1958 .., : , . .3
  • : .: 8 9065177866, : . , . , .9
  • " "" ( " ""): .: 19.05.2009 ., : 6901014056, : 1026900524815, : 690101001, : 28401000000, : .2 .21.1 08.08.2001 129-, : 170000, , -, , , 26.
  • : .: 89609025593 (), : . . 19
  • Jayanetti J P D S: : -, WP, Samicha Chilaw Rd Wariyapola
  • : : 3053323652, 06.08.1983 .., - - .., : , -
  • : 4.2.1985 .., - .., : www.ok.ru+ , id : 3228179,
  • : 08.01.1927 .., : , . . 49 . 4, .: (495) 3284723
  • : 11.9 .., : www.ok.ru+ , id : 27830460,
  • : 16.10.1983 .., : , ., 3.
  • : : www.ok.ru+ , id : 73129280,
  • Borovikov Denis: : , 1, 2, IRON MAN, : www.ok.ru+Borovikov Denis, id : 73179648,
  • : 1908 .., - . - - ..
  • : 07.07.1965 .., : , , 7.
  • : 8.4 .., : www.ok.ru+ , id : 3230648,
  • : : ., .235, : 3151201, 3169, 19 ..,
  • : 31.08.1957 .., : 21063, 9363, -, 1993 .., : 3050821, 2816571, .: 71084, : , , , 34.
  • : M & S Property Development Ltd, 4521, Head Office, Builders, : , , Unit 1, 105 Soho Hill, Birmingham, West Midlands, West Midlands, B19 1AD, B19 1AD, West Midlands, West Midlands, Birmingham, .: 448006982491, : Mr S Kenaghan (Director)
  • : 26.08.1961 .., : , . .11
  • : : www.vk.com/id220513395.
  • : 12.07.1956 .., : , 3- . . 12 . 2, .: (495) 1700548
  • : 10.06.1959 .., H . H - .., : , , 17.
  • : ²²Ͳ "Բ IJ Բ "" ( "Բ IJ Բ ""), : , 3127 ȯ, - 40-в , .120, . 1, .: , 3127 ȯ, - 40-в , .120, . 1, .: ̲Ͳֲ ̲ Ȫ, 18200, 01.06.2001 ., : 1) 1973812077, ̲ߪ , . 4917130 2) 2551707783, ² ˲ , . 4917130, : : 61110 IJͲ Ͳֲ : , ..: 4917130 ..: 4917130.
  • в : : 3358005594, 09.12.1991 .., - .., : ,
  • : 12.7 .., - .., : www.vk.com/id220000656.
  • : 1.5.1990 .., : www.vk.com/id221177671.
  • Dfgdfgdfgdfg Gdfg: : www.ok.ru+Dfgdfgdfgdfg Gdfg, id : 73150273,
  • : : www.ok.ru+ , id : 27788486,
  • : : www.ok.ru+ , id : 73341232,
  • : 27.1.1920 .., : )))))))))))))))))), : www.ok.ru+ , id : 27736397,
  • : : www.ok.ru+ , id : 27728794,
  • Andrey Andrey: : www.ok.ru+Andrey Andrey, id : 73473445,
  • Royce Rolls: 9.5.1993 .., : www.vk.com/id220921817.
  • : 7.2.1990 .., : ., : Formula 1, Spore, Heroes 3, Flatout, GTR evolution, - .., : , o, ̸ , , , 1-4 , .: 89628273995, : 2001: Space Odissey, Moebius, , , , , -, -1, Lost, , , , , Se7en, ..., : www.ok.ru+ , : , Russia, , TOP GEAR, : ABBA, Era, Baccara, , Mama Cass Eliott, id : 28042721, : 1, , ), : http://formula1.com.
  • : : www.ok.ru+ , id : 73742580,
  • : 1954 .., : , .,50 ,22
  • : 12.9.2000 .., .: 898247 , : www.vk.com/id220491002.
  • Ѳ: : 3184110057, 06.03.1987 .., .ȯ - .., : , .ȯ
  • Lol Olololol: : www.ok.ru+Lol Olololol, id : 73308260,
  • : 4.11 .., : www.vk.com/id220047070.
  • : 28.03.1931 .., : , . .14 .3
  • : : www.vk.com/id220006546.
  • : : www.ok.ru+ , id : 3258930,
  • : : www.vk.com/id220639038.
  • Capone Alphonse: 17.1 .., : www.vk.com/id220609521.
  • : 27.07.1951 .., : , , , 10
  • ²˲: : 2895422995, 10.04.1979 .., - .., : ,
  • : 21.07.1953 .., : , , , 6
  • : 17.10.1940 .., . , 4
  • : 02.07.1987 .., :
  • : 18.12.1986 .., .: (495) 2313160
  • : 26.3 .., : www.ok.ru+ , id : 3176926,
  • : : www.ok.ru+ , id : 27737815,
  • : 16.7 .., : www.ok.ru+ , id : 3075499,
  • : .: +380973958755, : , . , .1
  • : : , . 117, . (495) 1824466.
  • : 16.6 .., : www.ok.ru+ , id : 3151085,
  • : : www.vk.com/id220307702.
  • : 23.02.1989 .., : , . . 5, .: (495) 3851233
  • : 12.06.1941 .., : , . .7 .1
  • : 27.8 .., : www.vk.com/id146562603.
  • ò: 17.03.1970 .., : , - 5624286401, ., ., : SKODA, OCTAVIA, 48164, 2000 .., : TMBBE41U912430750.
  • : 15.3.1999 .., - .., .: 375233_8_991_, : assassin6869916, : www.vk.com/id146935687.
  • : 01.01.1900 .., : , - 5940200000, ., 24, : VOLKSWAGEN, JETTA, 07700, 1986 .., : WVWZZZ16ZGW184422.
  • : : www.ok.ru+ , id : 73562368,
  • : 29.1.1956 .., : www.vk.com/id220649128.
  • : 15.03.1925 .., , . . 34 . 3, . (495) 4876029.
  • : 05.11.1960 .., : , , ( -).
  • : , . . 8 ,
  • : 07101983 .., - .., : - ..
  • () : 3.11 .., : www.ok.ru+ () , id : 27713850,
  • : 03.10.1953 .., : , : "" 5256081819, : , .
  • : : www.vk.com/id219980144.
  • : 21.04.1929 .., : 01, 054002, , 1992 .., : 104, : , ., , 65.
  • : 8.9 .., : www.vk.com/id220820593.
  • : : www.ok.ru+ , id : 3103721,
  • : 16.1.1996 .., - .., : www.ok.ru+ , id : 27920876,
  • : 17041990 .., - .., : - . . .60.
  • Radikovna Alena: 4.4 .., : www.vk.com/id146560488.
  • : 11.12.1985 .., - - .., : 45634, : www.vk.com/id146481150.
  • : 01.02.52 .., : , , . , ., 159, 120. : . , 456800, ., 188
  • : : Richardson_na, : www.vk.com/id220972350.
  • в : : 3134611918, 27.10.1985 .., - .., : ,
  • : .: 89144735964 (), : . (.), . 2-
  • : 05.01.1926 .., : , . . 22 . 2, .: (495) 3185353
  • ..: , . 18 ,
  • : 01.04.1980 .., : , .10, : 20.09.2005
  • : 20.3 .., : www.vk.com/id220417499.
  • Y?ld?r?m Caner: 23.3.1973 .., : www.vk.com/id220883294.
  • : . , . 10
  • : 27.11.1990 .., : , . .1 .1
  • Bahce Fener: 19.4.1989 .., : www.vk.com/id220448176.
  • : 10.8.1990 .., - .., : www.vk.com/id220686232.
  • ADANI GUYMR: : --> -, : Israir Airlines and Tourism.
  • Abdilov Ondasin: : www.vk.com/id221190210.
  • : : www.vk.com/id220752371.
  • : 03.02.1960 .., : , , .( -).
  • : : , : , : , .: 46564564, : , : www.ok.ru+ , : , : , id : 73375512, : hghjfhljdf, : asdasd.
  • Xxx Zzzz: : www.vk.com/id146744229.
  • : 23.11.1996 .., : www.vk.com/id220852260.
  • : - .., : , - - . - 12,
  • Lomonosov Micha: : www.vk.com/id220066117.
  • : 19.04.1990 .., : ,
  • : : , . . 54, . (495) 9118509.
  • Unknown : .: 89104190645, : www.ok.ru+Unknown , id : 3259090,
  • : : www.ok.ru+ , id : 3273064,
  • : 18.08.1942 .., : , . .29/1
  • : .: 8 (3832) 231725, : , , 16
  • : 20.10.1955 .., : , .
  • : : www.ok.ru+ , id : 73583354,
  • : ײͪ ϲȪ ί ϲ " ̲ ϲ" ( CC " ̲ ϲ"), : , 29000 , , . , .5, .: , 29000 , , . , .5, .: ̲ ί ̲ί ί Ҳ, 16731060005000942, 04.06.1993 ., : 1) 1773299, ϲ , : : 71120 в ò ί ֲ : , ..: 559273 ..: 555992.
  • : : www.vk.com/id220129445.
  • : 17.10.1978 .., : . - ., : " "" 7707179242, : , .
  • : 03.11.1972 .., : , , , 5
  • : : , . .121/1 .2
  • : 17.12 .., - .., : yulechka19923, : www.ok.ru+ , id : 27732463,
  • : 05.02.1989 .., : , , 2-
  • : 15.5.1979 .., : www.ok.ru+ , id : 3208241,
  • : 01.02.87 .., : , , ., 18
  • : - .., : www.vk.com/id221069587.
  • : 22.6.1979 .., - .., : www.vk.com/id220318481.
  • : 28.1.1981 .., : www.vk.com/id221113860.
  • Tarasenko Irina: 11.11 .., : www.ok.ru+Tarasenko Irina, id : 27944586,
  • : : www.ok.ru+ , id : 73493661,
  • Ia Propala: : www.ok.ru+Ia Propala, id : 3200927,
  • : : www.vk.com/id220111866.
  • : : 3110816739, 03.03.1985 .., - .., : ,
  • : .: 8 9056980915, : . . . 40
  • : 29.12.1992 .., ?? - .., .: ,), : www.vk.com/id220611166.
  • : 6.12.1997 .., - .., : www.vk.com/id220487757.
  • : 23.7.1987 .., : , : www.ok.ru+ , : , id : 73408234,
  • ERICK JOEL HENRY PIE: : CUBANA, : , , LINDERO 15 AP.E SANTO TOMAS Y CLAVEL; ..: 368010100430173, : LINDERO 15 AP.ESANTO TOMAS Y CLAVEL
  • : 25.06.1922 .., : , 1- . . 22, .: (495) 3684242
  • : 1954 .., : , .
  • : YAMAHA DT, (), , , , 250272, 1992 .., : , :
  • Dree Mr.: : www.ok.ru+Dree Mr., id : 27853543,
  • : 21.01.1959 .., : , , , , , 16
  • : 01.10.1947 .., . , . .9
  • GidMotors.ru : .: +7 (812) 930-52-59, @-www: www.gidmotors.ru, : -, . , 10, . , . 306, : -, , , -, ,
  • : - .., : www.ok.ru+ , : tereeshaaa, id : 73501928, : http://sprashivai.ru/Tereshaaaaa.
  • AL RIFAA STAR INTERIOR DECORATION : : -, (), 30618, Dubai, : 97143934165, : Engraving & Ornamentaion Works
  • : : www.ok.ru+ , id : 73755671,
  • : : www.vk.com/id146567881.
  • : 19.05.1940 .., : , , , ., 10
  • : 18.8 .., : www.vk.com/id220283552.
  • : 10.06.1963 .., : 350, 2247, , 1986 .., : 218073, 042728,
  • : 29.07.1928 .., . , . .8 .2
  • : : www.ok.ru+ , id : 27899528, : http://vkontakte.ru/id27899528.
  • ..: : , ,, 35 , .: (86/) 37803.
  • : 30.01.1986 .., : , .
  • : 17.12.1957 .., : www.vk.com/id220634347.
  • : 22.02.1966 .., : , . .168
  • Covaci Natalia: 31.1.1983 .., : www.vk.com/id146548225.
  • DANTU County DINGGANG JIAMEI Electroplating equipment Factory: : LIN,JIANPING, : galvanizing equipment . metal electrical appliances . electroplating hanging utensil . pressing fittings ., : , 212134, Jiangsu, Zhenjiang, PINGCHANG Village, DINGGANG Town, .: (511) 3564144.
  • : 18.1 .., : www.vk.com/id146604180.
  • : : ., . -, 27
  • : 21.10.1951 .., : , . . . 16/2, .: (495) 9637738
  • : .: 89144315784 (), : . (.), .-,
  • : 22.10.1962 .., , . 29, . (495) 7312554.
  • ): .: 28.08.2012 ., : 1126200002312, : 61401000000, : .2 .21.1 08.08.2001 129-, : 390046, , , , 12.
  • : 28.7 .., : www.ok.ru+ , id : 27990117,
  • Gsdfgdsfg Xcvzxbvc: : www.ok.ru+Gsdfgdsfg Xcvzxbvc, id : 73871112,
  • - : : www.vk.com/id220087364.
  • : : www.vk.com/id220096151.
  • : 1931 .., : ., , ., , 57
  • : .: 89067639487 - . ( , , , : , : 29000 .), : , .
  • : 18.08.1940 .., : ., , , .210
  • : 01.02.1933 .., : , , 21 55
  • : 19051959 .., : ., .49, : 111130, 23364, 2001 .., : XTC11113010179148.
  • : : www.vk.com/id220260356.
  • : 13.11.1946 .., :
  • : : www.vk.com/id220588811.
  • : 01.11.1974 - .., : , , , , , 149, : MERCEDES BENZ 230 E, , B628TNM, WDB1240231B613901, 1991 ..
  • : 11.5.1997 .., : www.vk.com/id221144488.
  • : ..: 8 9172803619, : , . , . , . , , 423603
  • : 06.06.1941 .., : , . . 3, .: (495) 4027051
  • : : www.ok.ru+ , id : 73224315,
  • : : ., .14
  • : 25.04.1926 .., : , . . 2, .: (495) 3777796
  • : 20.7 .., : , - - .., : . , : avatar, : www.ok.ru+ , : , id : 73298896,
  • : 25.5.1983 .., : www.vk.com/id220174402.
  • : 3.9 .., : www.vk.com/id220621365.
  • : .: +7 (4962) 64-60-52, : ., ., . , 3/2, www.lipsen.ru, : , , ,
  • : 12.02.1957 .., : 21093, 37702, , 21083, 1999 .., : 2109302586604, 2586604, 2703268, : , , , 69.
  • : 29.09.1999 .., : , .131 .1
  • : 21.04.1979 .., : , , . .
  • Uringa H: .: 592315689, : , , 9401KK, Assen, Oranjestraat, 56.
  • : : www.vk.com/id146470759.
  • Varrella Fabio: : www.vk.com/id220976837.
  • : 05.11.1949 .., : 98530, , , ., ., ., 15.
  • : 23.11.54 .., : , , . , ., 1. : " ", 457670, .
  • Nik Nik: : www.ok.ru+Nik Nik, id : 73217071,
  • : .: 8 9145727040 - , : ., 675000 27
  • : 17.02.1974 .., : , . .6
  • 28.11.1960 ..: : ., . .220
  • : 09.06.1976 .., : , . .8 .2
  • Armanidis Kostas: : www.vk.com/id220340475.
  • : 08.03.1954 .., . , .86 .5
  • Xot Immi: : www.vk.com/id221043468.
  • : 04.02.1986 .., , . . 19, . (495) 4219158.
  • : 17.4.1999 .., : www.vk.com/id220281150.
  • : 1952 .., : 154. :
  • Zaremski Kewin: 7.5.1998 .., : www.vk.com/id221063394.
  • : 01.12.1954 .., : ., . -, 22
  • : 3.6.1976 .., - .., : www.vk.com/id146649100.
  • : 15.12.1984 .., : www.vk.com/id220389526.
  • ²˲ ²²: : 3142513876, 14.01.1986 .., в - .., : , в
  • : 04.12.1959 .., : , .,,83
  • : : , 21, .: 8 (8512) 229604.
  • : : www.vk.com/id219983583.
  • : 17.04.1961 .., : , . . 6, .: (495) 1755313
  • ò: : 3032923395, 14.01.1983 .., - .., : ,
  • : 17.05.1985 .., : , , .
  • : : www.ok.ru+ , id : 73388167,
  • ˲: : 793406630, 21.09.1921 .., ˲ - .., : , ˲
  • : 24.05.1960 .., : ., , , 44
  • : ..: 8 9063218739, : , 420000 . . 5
  • : 07.01.1975 .., : , : "" 5262135269, : , .
  • : 6.3 .., : www.ok.ru+ , id : 73155464, : http://steamcommunity.com/profiles/76561198038409889.
  • : 23.07.1958 .., : ., . -, 28
  • : .: 8 9066739282, : . . 61
  • : - - .., : www.ok.ru+ , id : 73860384,
  • Agapi Victor: : www.vk.com/id221067310.
  • : 19.08.1952 .., : , . 14
  • : : www.ok.ru+ , id : 73164556,
  • : 21.12.1989 .., : --, , 439
  • : : - --> , : Avia Traffic Company.
  • : : www.ok.ru+ , id : 73665923,
  • : 18.06.2001 .., : ., . . . 4.
  • : 05.07.1943 .., : , , , 8.
  • : 25.08.1996 .., : , ., . , 19
  • ..: .: 8 (8442) 330618, : . , .20
  • : : www.vk.com/id146731407.
  • : 29.01.1943 .. : .
  • : 01.01.1900 .., : , - 5940700000, ., 100, : , 31121, 0097, 1985 .., : 0, 046621.
  • () : 6.1 .., : www.ok.ru+() , id : 28021759,
  • : 25.01.1975 .., : . -, -, ., 105, .: (812) 1530943.
  • : 6.7.1969 .., : ---- !!!, : !, - .., : , : www.ok.ru+ , : , id : 3227979,
  • : 29.12.1988 .., : , , , 2.
  • : 26.02.1936 .., : , . .22 .2
  • : .: 8 (812) 1585521, .: 9478067 (Tele2), : , C-
  • : 23.04.1969 .., :
  • : 03.08.23 .., : , , . , . , 58
  • : 11.10.2001 .., : , ., .41.
  • : 08.12.2001 .., : , , .
  • : 26.04.1987 .., : , 368222,
  • : : www.ok.ru+ , id : 27712479,
  • : 4.1 .., : www.ok.ru+ , id : 73586175,
  • : .: 8 9502805228, : , , , 26
  • : : www.ok.ru+ , id : 3293628,
  • : ..: 8 9178574365, : , . , 15, . , . , , 420000
  • : 28.5 .., - .., : , : www.vk.com/id220115126.
  • ): .: 25.07.2007 ., : 5944180264, : 1075900005532, : 594401001, : 57240501000, : .2 .21.1 08.08.2001 129-, : 618120, , -, , , 20.
  • : 28.09.1962 .., : ., , , 47.
  • : 15.09.1926 .., , . . 58, . (495) 1720354.
  • : : www.ok.ru+ , id : 73390730,
  • : 04.08.2001 .., : ., . , . 11
  • KLC GIDA URUNLERI ITH.IHR. VE TIC.A.S. - , : KEMIKLER KOYU MILAS-MUGLA, MILAS BODRUM KARAYOLU 18 KM., : " ", : 121552, , ., .,.2, : - 8(903)754-24-93, : (ONCORHYNCHUS MYKISS), ,, . . . . TR 46 20 30 40 513, . 926100: - BAFA SU URUNLERI YAVRU URETIM MERKEZI SAN.TIC. A.S.
  • : 12.09.2004 .., : , .22 .2
  • : 01.08.1935 .., : , . .59 .1
  • : - .., : www.vk.com/id220209533.
  • : 11.1.1990 .., .: , : www.ok.ru+ , id : 73204137, : www.ranetki.ru.
  • : 12.07.2004 .., : - , ., ., 4
  • : 15.10.1974 .., : , 4- .1
  • : : www.ok.ru+ , id : 27737218,
  • : : www.ok.ru+ , id : 73530713,
  • : 6.5.1998 .., .: 8937*******, : www.vk.com/id146706724.
  • : 01.01.1970 .., : , , , 22, : 986 , 53597, 1999 .., : W0ZZZ98ZS603863.
  • : : odessa, : lesya-gnatkova@rambler.ru
  • : : www.ok.ru+ , id : 73604208,
  • LIYANG City XINYI Property Temper Co.,ltd.: : PAN,ZHIPING, : property temper and broker service , property evaluation , real & estate information cosulting ., : , 213300, Jiangsu, Changzhou, No. 34--2, BEIMENWAI, BEIDA Street, .: (519) 7221704.
  • ² : 01.01.1900 .., : , - 5920950100, , 5, : , 968, 7865, 1982 .., : 416912, 405512.
  • Df Sdfsd: : www.ok.ru+Df Sdfsd, id : 73196833,
  • : 23.05.1925 .., : ., . -, 17
  • : 31.08.1971 .., : , - 5922650100, , 132, : , 2140, 22339, 1980 .., : 754868, 609490.
  • Goo Paul: 29.1 .., : www.ok.ru+Goo Paul, id : 3150037,
  • ˲ : : 1356621632, 21.02.1937 .., ʲ - .., : , ʲ
  • : 7.6.1989 .., : www.ok.ru+ , id : 73244538,
  • : 23.02.1943 .., , . . 4 . 2, . (495) 4221833.
  • WUXI City Suburb HELIEGAO CUIHUA Vegetable TAN: : GAO,CUIHUA, : vegetable, : , 214064, Jiangsu, Wuxi, ZHIDINGWEI, XUXIANG Market.
  • : 12011974 .., : ., .34, : 2101, 00564, 1981 ..,
  • Umrbekovich Umarbek: : www.vk.com/id221209725.
  • Fogan Hastya: 19.11 .., : www.vk.com/id220861850.
  • ˲: : 3134112931, 22.10.1985 .., - .., : , Ͳ
  • : 9.7.1981 .., : www.vk.com/id220569288.
  • \\ : : www.vk.com/id146830840.
  • : : www.ok.ru+ , id : 73852014,
  • : 07.02.1979 .., : . - / -
  • : . .: 8 9056377543, : . . 50 13
  • : - .., : www.ok.ru+ , id : 73287551,
  • : : Katrin, : www.ok.ru+ , id : 3147290,
  • : 11.01.1960 .., : 443125, , , , , 10, : 320500, , , 844163*, 32050096005758, 96005758, 029465, 1996 ..
  • : : www.vk.com/id220372201.
  • : 580608 .., - .., : ., . , , . 58, : 850, 37335, 1996 ..
  • : 12.10.1950 .., : www.ok.ru+ , id : 3113593,
  • : : www.vk.com/id221183795.
  • : 28.09.2003 .., : , .
  • : 13.10.1972 .., : , . . 54 . 5, .: (495) 9322441
  • : 12.09.1928 .., : , , ., 4
  • : 09.03.1961 .., : ., .35
  • : 25.7 .., : www.vk.com/id220818354.
  • Rouse Denny: 7.1.1992 .., : -. , ! , ..., : ?*-..-*, - .., : !, : , , , , , , 2, , , , , , , girls, , , , , , , ., : www.ok.ru+Rouse Denny, : cosmopolitan , , , COMEDY club)))))))))))), : LTL++TL TT TTL+L + =LTT++=L! =), id : 73199374, : =)) a , , , , , , a, , , , , , , a a, , a , , , , , , , )), , a , e, , , a, , ***, , , e e, , , , , , , , , , , , -, , , , , , , , , , , , , , , , , , , , , , =) : , , ,, , ..., =(,
  • : .: 8 9024850969, : , 100 , 100-
  • : 15.12.1932 .., : , . 10, .: (495) 4142245
  • : : www.ok.ru+ , id : 73162367,
  • ò в: : 3010424152, 03.06.1982 .., ² - .., : ,
  • : 28.09.1929 .., : , . .10
  • : 18.01.1944 .., : 2102, 59402, , 1978 .., : 0289631, 2830726 2101, : , ..
  • : 08.10.1940 .., : , , ., -, ., ., 7, : 21061, -, 6015, 2106102998161, 2998161, 2690884, 1993 ..
  • : 04.08.1999 .., : , . . 24, .: (495) 2898845
  • Be pozzzitif : : www.ok.ru+Be pozzzitif , id : 73246762,
  • UMM SQAIM LAUNDERERS & DRY CLEANERS: : -, (), 71997, Dubai, : 97143352352, : Laundries & Dry-cleaners
  • : 24.09.1972 .., : ., , , 57
  • : : www.vk.com/id219984371.
  • ˲: : 3147213619, 02.03.1986 .., ̲ - .., : , ̲
  • : : , . . 17, . (495) 4523839.
  • : : , .: 8 (8612) 674312.
  • : 16.4.1993 .., : , , : CS, , - .., : , .: , : ))))))))), : www.ok.ru+ , : , : , Dj Aligator, id : 73647335, : , : .
  • : 29.03.1952 .., : , , .
  • : : , : www.ok.ru+ , id : 73676249,
  • Steve Evren: : www.vk.com/id221077263.
  • Hoogeland Andre: : www.vk.com/id220078751.
  • Alexei: 6.11 .., : www.ok.ru+ Alexei, id : 3251547,
  • : 20.09.1956 .., : 95024, , , .ѳ, .60- , 37.
  • : : ., . -, 18
  • Abdullayeva Sebnem: 9.1.1999 .., : www.vk.com/id220866095.
  • : . , - 2- . .54
  • : 26.7 .., - .., .: Samsung GT-S5360, : Karina Filippskaja, : www.vk.com/id146497101.
  • 22.06.1941 ..: : ., .
  • : 18.01.1940 .., . , . .8
  • : 27.03.1961 .., : . -, -, ., 17/8
  • Lucia Santa: 6.3 .., : www.vk.com/id220445809.
  • Konohova Polina: 26.12 .., : www.ok.ru+Konohova Polina, id : 3074266,
  • : .: 8 4232969694, : , , 42
  • : 12.01.1937 .., : , .
  • : : www.ok.ru+ , id : 27736876,
  • : : , : dbs1993@mail.ru
  • : 12.11.1987 .., : www.ok.ru+ , id : 3201464,
  • : 05.07.1940 .., : , , 78, : -, .: 8 (3812) 232549, : 31105, 36455 ..
  • : .: 89144618958 (), : . (.), . . 438
  • Ssd Ssd: : www.vk.com/id221024541.
  • : , . . 58 . 3 ,
  • : 14.02.1952 .. : . : " "". .: 225268.
  • : 12.4.1968 .., - .., : www.vk.com/id220847869.
  • Dijk C: .: 786761765, : , , 3274KH, Heinenoord, Kuipersveer, 23.
  • : 7.11 .., : www.ok.ru+ , id : 3094232,
  • : : , . . 19, . (495) 4272559.
  • : 05.03.1947 .., : . -, -, ., 181
  • : : 1476110695, 31.05.1940 .., ʲֲ - .., : , ʲֲ
  • : : www.vk.com/id221106836.
  • : : www.vk.com/id220285077.
  • : 04.03.1935 .., . , . .8
  • Stargate Titos: : www.ok.ru+Stargate Titos, id : 73167429,
  • : 07.10.1961 - .., : , 19010004, 19012634, , 5 , 8, : 8131, , 7588ZB, .., 1990 ..
  • : 20.09.1930 .., : .- . .31
  • : 30.10.1966 .., : , .,,4
  • 143214: .: 8 (800) 200-58-88, +7 (49638) 5-29-39, : ., -, ., 33, www.russianpost.ru, : , , - , , , -
  • : : , : , : , : www.ok.ru+ , : , : , id : 73097458, : ,
  • : 2.3.1985 .., : www.vk.com/id220920456.
  • : 29.09.1959 .., : ., , , .20
  • : 01.02.27 .., : , , -., .
  • 11 45 (2000.09.15 ): .: 8 (473) 278472
  • : 21.11 .., : www.ok.ru+ , id : 73392359,
  • : 05.10.1926 .., : , .,-, .46
  • : 05.12.1959 .., : ., , . , , .66
  • : : , - .22.
  • : 11.12.1977 .., , . 31, . (495) 9059938.
  • : 29.02.1992 .., : , . 65.
  • : .: 8 (3832) 516823, : , , 12
  • : 19.01.1962 .., : , , -.
  • : 21.07.1964 .., : ., , , .8
  • : 23.8.1992 .., : www.ok.ru+ , id : 28032910,
  • : : , 140200, , ., ., ., .12
  • : 03.02.1935 - .., : , 3271, , 79456, 1992 .., : . .1 .
  • : 01.01.1900 .., : , - 5940200000, ., 24, : , 2121, 2579, 1983 .., : 0303493.
  • : 11.2.1941 .., : www.ok.ru+ , id : 73554931,
  • : : ., . -, 24
  • : 08.10.1935 .., - - . - .., : . 74
  • : 30.08.1949 .., : , . .424
  • : : www.vk.com/id221186831.
  • : - .., : ... ! , . ! ! . ! , ! !!!!!!!!!!!!, : www.ok.ru+ , id : 73746330, : ,
  • : .: +380971369630, : , 80325, I, ., I -,
  • : : , / 59351
  • : .: 8 9609006349, : 630099 . . 73
  • : . , . .5
  • : : www.vk.com/id220300221.
  • Suarez Avalos Gisela Caridad: .: 6491837, : , S. Suarez, Milagros #303 ,5 , e Cortina y J. Bruno Zayas,S. Suarez,1
  • : 26.06.1981 .., : . -, -, ., 8
  • : 15.5.1970 .., : , : , : , : , : www.ok.ru+ , : , : , id : 3187987, : ,
  • : 28.10.1978 .., : , , , 17
  • : 12.10.1965 - .., : , - , , , : 2121 , , T440DAM, 0847820, 1993 ..
  • | ..: .: 0503166, : , , . . 3
  • : 16.03.1916 .., H - .., : , , 23.
  • : 13.11.1987 .., : >,V@N|{<,, : www.ok.ru+ , id : 3107011, : www....
  • : : www.vk.com/id146796294.
  • : 20.4.1989 .., : www.ok.ru+ , id : 3128936,
  • : : www.vk.com/id220053738.
  • Ѳ : : 3021219254, 19.09.1982 .., .ȯ - .., : , .ȯ
  • : : www.vk.com/id220521245.
  • WUXI City Suburb LIUTAN DACHANG Granite Factory: : LIN,YAOXING, : stone materials for building processing, : , 214173, Jiangsu, Wuxi, No. 310, XICHENG Road.
  • : 21.03.1969 .., : , - , , 22.
  • : 1953 .., : , .,,273/
  • : : www.vk.com/id220438149.
  • : : www.ok.ru+ , id : 73869249,
  • : .: 8 9242553687, : , ; , 20
  • ˸: 14.8 .., : www.vk.com/id220487693.
  • : 22.9 .., : www.vk.com/id220971111.
  • : 09021937 .., : ., .28, : 21099, 646170, 2000 .., : XTA210990Y2762565.
  • : 07.01.1939 .., : , , ., -, ., ., 38, : 2705, , 50463 *, 270500V0046633, 0046633, 0046633, 0062817, 1997 ..
  • : : , - , , , , /, : 52, , X382CA, , 1988 ..
  • : 03.10.1963 .., : ., , , 26.
  • : : www.vk.com/id220590488.
  • : 22.2 .., : , : www.vk.com/id146562071.
  • Sahane Berke: 15.5.1998 .., : www.vk.com/id220105497.
  • : : , : www.ok.ru+ , id : 73722190,
  • : : www.ok.ru+ , id : 27941026,
  • : 01.04.1971 .., : , . .16
  • Jesser Ratheesh: : www.vk.com/id220813631.
  • " ": : . , .: 8 (3452) 390690.
  • : .: 8 4232730140, : , , 2-84
  • : : --> -, : .
  • : : www.vk.com/id221129736.
  • в ò : : 2501821178, 30.06.1968 .., - .., : , Ͳֲ
  • : 06011984 .., - .., : . . .314
  • : : www.vk.com/id146503057.
  • Cediel Infantes y Olbes Jaime: : 28006, Madrid, .: +34 915.625.472
  • : - .., : www.ok.ru+ , id : 27803570, : . ->, vk.com/askme#id1309343.
  • Ciccarelli Fabrizio: 25.8.1989 .., : www.vk.com/id221169876.
  • Hong kong HENGSITE Pacific ocean Co.,ltd. TAICANG Office: : YUE,HAN, : same as trading professional work liaison cosulting , service, : , 215400, Jiangsu, Suzhou, 36 Building, GUOTAI Garden, TAIPING NAN Road, .: (520) 3540102.
  • : 27.06.2008 .., : , 101
  • ..: : - , , .: 8 (3466) 220096.
  • : 5.12.1988 .., : , - .., : , , (Texas Hold',em), - .., : , : , , , - , , , , !, : www.ok.ru+ , : , : TT ! Linkin Park, Prodigy, Rammstein, 2pac, 50 cent, T, P.Diddy, Nas, Jay-Z, Sean Paul, Eminem, Rihanna , id : 3088301, : , ,
  • : 06.04.1938 .., : , . .21
  • : : www.vk.com/id221108169.
  • : 29.11.1986 .., : , -
  • : 26.04.1981 .., .: 8 9042838538 - , : ., 676631 . 157 . 49
  • : 1963 .., : , 10
  • : 08.08.1952 .., : , , , 41
  • : 16.07.1976 .., : . . . " ", : ., .25/69
  • Doherti Shennen: : * , ., : [], : ...., () - .., : ...... ., .: , : ).... .), : www.ok.ru+Doherti Shennen, : Led Zeppelin, Pink Floyd, U2..., id : 73580887, : , ...).... . )... ...., : . ....
  • : 18.04.1957 .., : , , 2- 9.
  • : 25.1 .., - .., : www.ok.ru+ , id : 73158966,
  • : 07.07.1960 ..
  • : : www.ok.ru+ , id : 27922134,
  • : 13.11.1982 .., - .., : www.ok.ru+ , id : 3287689,
  • : 21.07.1984 .., , . . 73 . . 73, . (495) 1215188.
  • : : , : www.ok.ru+ , id : 27743606,
  • : 01.01.1970 .., : . . 27, : , 7266, 1995 ...
  • : 6.7 .., : www.vk.com/id220715630.
  • : 17.06.1989 .., : , , : "".
  • : 19.2.1986 .., - .., : www.vk.com/id220590206.
  • Den Denchik: : www.ok.ru+Den Denchik, id : 73278121,
  • : - .., : www.ok.ru+ , id : 73406387,
  • : 18.09.1943 .., : ., . -, 27
  • : 04.11.1958 .., . , . .39 .1
  • : 24.03.1937 .., : ., . -, 16
  • Borisovich Konstantin: : www.vk.com/id221197715.
  • : 06.04.1937 .., : , , , 35
  • : 21.8.1997 .., : www.ok.ru+ , id : 73422642,
  • : : , 33, .: 8 (8512) 284545.
  • : , . . 4/24 ,
  • : : www.ok.ru+ , id : 27745573,
  • Smit A P: .: 235389558, : , , 1991TX, Velserbroek, Grote Buitendijk, 194.
  • : . .: 8 9059175897, : . . 65
  • : 11.5.1994 .., : www.vk.com/id221113460.
  • : 24.04.1946 .., : , .
  • TONGZHOU XINSHENG Building material Co.,ltd.: : MA,YIXING, : foaming slab , manufactory , marketing, : , 226343, Jiangsu, Nantong, QI'AN Town, .: (513) 2567952.
  • : : www.vk.com/id221158321.
  • в: : 3153313159, 02.05.1986 .., в - .., : , в
  • : 14.04.1976 .., , . . 9 . 2, . (495) 2119363.
  • Heroine Your: : www.ok.ru+Heroine Your, id : 27909265,
  • Mol C P: .: 118461433, : , , 4388HJ, Oost-Souburg, Kromwegesingel, 13.
  • : 21.3.2000 .., - .., .: , : sasha100007, : www.vk.com/id220240557.
  • : : , ., : , - .., : , .: +375297067067, : , - 1, 2., : www.ok.ru+ , : , ...., : , id : 73236715, : , , ..,
  • : : www.vk.com/id219983505.
  • : 01.12.1985 .., , . . 21 . 4, . (495) 1472082.
  • : 23.11.1989 .., : , . .5
  • : .: 8 (812) 9135720, .: 6330144 (Tele2)
  • : 2.12.1981 .., : www.ok.ru+ , id : 3080743,
  • : .: 8 (8312) 655815, : . , , 5
  • : : , : www.ok.ru+ , id : 3086410,
  • : 8.8.1986 .., - .., : www.ok.ru+ , id : 73576904,
  • : 08081950 .., : ., .3, : 21102, 644270, 2004 .., : XTA21102040753366.
  • : 20.10.1927 .., . , . .9
  • ˲ ˲: : 3163115917, 08.08.1986 .., - .., : ,
  • : : www.ok.ru+ , id : 73428228,
  • : 31.10.1963 .., : . , : " "" 5256027498, : , .
  • Neau William: : www.vk.com/id220718621.
  • 01.01.1930 ..: : ., . . .33
  • : 8.8 .., - .., : www.vk.com/id146815833.
  • " -19 " - " -19 ": , : 0 ., ./: 275-40-17, 275-40-17, : - , : 0, : 49987420, : , : 193036, 193036, 275-40-17.
  • : : www.vk.com/id220902784.
  • : : www.vk.com/id220822071.
  • : 01.05.1940 .., : , . . 15, .: (495) 3904374
  • : 31.05.1945 .., , . . 9, . (495) 3016025.
  • : . .: 8 9059490982, : 652990 . . 34
  • : 8.4 .., : www.vk.com/id221057220.
  • : : --> , : Sky Express.
  • : 31.05.1983 .., : , , 162.
  • : Tramont Translation Management: : Head Office, : GB NW3 2UL 57 Upper Park Road London, 57 Upper Park Road GB NW3 2UL London United Kingdom, : N. Fry - Chairman, : 448456448259, tramont@globalnet.co.uk, http://www.tramont.co.uk, : Services : 5.
  • : : www.vk.com/id221071449.
  • (): .: 14.07.2007 ., : 7703192595, : 1077757932361, : 770301001, : .2 .21.1 08.08.2001 129-, : .
  • : 15.01.1965 .., : , .
  • : 30.8.1976 .., : www.vk.com/id219985877.
  • : 20.07.1958 .., : 412, 28202, , 412, 1994 .., : XTK4120R0393127, 0393127, 7290443, : , , , 12.
  • : : www.vk.com/id146635206.
  • : : 375, 3046, , 1979 .., : 316739, 067999, : , .
  • : 24.02.1968 .., : 624351, , . , . 4-, . 21, .: 89505461037, : (:624351, , . , . , . 2,) :
  • : : www.vk.com/id220447010.
  • : : www.ok.ru+ , id : 73819154,
  • Ҫ : : 3353405530, 24.10.1991 .., - .., : ,
  • : : www.ok.ru+ , id : 3156917,
  • : . , . , ., . 15
  • War Moon: : www.vk.com/id220259630.
  • : 11.6.1990 .., : www.vk.com/id146571576.
  • : 26.03.1961 .., : .14
  • Kemerbek Rinat: - .., : www.vk.com/id146720465.
  • : 28.09.1946 .., : , . --, , 59. : / 32189, : , 26, : .., .: 89141859757.
  • : .: 89046, : www.ok.ru+ , id : 73306054,
  • Sanz Herreiz Emilio: : 28005, Madrid, .: +34 914.744.584
  • OMNIBUS URBANOS METROBUS: .: 2725460, : , SIBONEY, PLAYA, 15 182 Y 184 SIBONEY PLAYA
  • : : , . .307
  • : .: 8 918 65 4 ------, : www.ok.ru+ , id : 73502286,
  • : : , . . 847, . (495) 5316617.
  • ..: .: 8 (49657) 55657, : , . , 43
  • : : www.vk.com/id146846656.
  • : 09.08.1962 .., : , , , 36.
  • : 28.4.1991 .., : www.ok.ru+ , id : 27968385,
  • : 29.2 .., : *SEXY*, : www.ok.ru+ , id : 73242350,
  • : .: 89144773105 (), : . (.), . 8
  • "-" ( "-"): .: 08.04.2009 ., : 6168003330, : 1056168007752, : 616801001, : , : 344000, , -- , , 58.
  • : 15.09.1985 .., : .,..
  • : 21.4.1999 .., - .., .: , : kubasovi2012, : www.vk.com/id220190401.
  • в : : 2709922175, 12.03.1974 .., - .., : ,
  • : 19.01.1962 .., : . -, -, -, 80, .: (812) 1562362.
  • : 01.01.1939 .., : ., , , 32.
  • Falcone Paolo: : www.vk.com/id220322747.
  • : 1.1.1920 .., -- - .., : www.ok.ru+ , id : 73640593,
  • : 29.1.1981 .., : www.vk.com/id220006607.
  • ²: : 2835019838, 14.08.1977 .., ͪ - .., : , ͪ
  • : 24.12.1981 .., , . . 61, . (495) 3444634.
  • : NISSAN SUNNY, (), , , , 6680, 1986 .., : , :
  • (): .: 10.12.2012 ., : 0265000528, : 1020201934268, : 026501001, : 80435000000, : , : 452607, , , , 13.
  • ? : : www.vk.com/id220079841.
  • : 09.12.1948 .., : .:; .
  • Cat Polina: 3.2.1989 .., - .., : www.vk.com/id220222498.
  • : : www.ok.ru+ , id : 73843992,
  • : 21.1 .., : www.vk.com/id220875664.
  • : : www.vk.com/id220414330.
  • H H: 03.06.1937 ..
  • : 7.10.1992 .., - .., : www.vk.com/id220867739.
  • : : ., -, ., 0, : 11, , 0081, , 1985 ..
  • : 4.10.1997 .., : , .: 89056757818 , : , , : www.ok.ru+ , : , : , id : 73576679, : ,
  • : 28.4 .., : www.vk.com/id220556472.
  • : 29.1 .., : www.ok.ru+ , id : 3246226,
  • : 25.03.1954 .., : .,
  • : 22.04.1937 .., : , 2- . . 4, .: (495) 1435305
  • : 27.7.1960 .., - .., : www.vk.com/id220347281.
  • : 07.02.1980 - .., : , 21061, , 22556, 1997 .., : - .5
  • Ivanencko Anton: : www.ok.ru+Ivanencko Anton, id : 73468976,
  • : - .., : www.ok.ru+ , id : 73708813,
  • : 20.6.1991 .., : www.ok.ru+ , id : 73819517, : .
  • : : www.vk.com/id220902266.
  • : .: 8 (921) 3519914, 5267451
  • : 30.10.1992 .., : www.vk.com/id220480199.
  • : : www.vk.com/id146823825.
  • : : www.vk.com/id146751236.
  • ..: : ., , , 2, .: 8 (8184) 35214.
  • - : 1980 .., : , 5
  • : 11.1.1994 .., - .., : www.vk.com/id220500135.
  • : 02.12.1971 .., : , . .9 .3
  • : 08.10.2007 .., : ., : , .
  • : 5.11 .., : www.ok.ru+ , id : 73586043,
  • : 08.05.1955 .., : .,- -,., : , .
  • : 19.07.1921 .., : , . .1416
  • " . ." (" . ." ): .: 07.01.2013 ., : 2265002783, : 1022202525223, : 226501001, : , : 659706, , -, , -.
  • : : www.ok.ru+ , id : 27865945,
  • : 01.01.1951 .., : ., . -, 25
  • : - "". : , -, - , 16. : 7-61-79, 7-61-79. : 886500 . - " " - . : 52-94-03. - "" - . : 52-09-36. - "-" (). : 200 .
  • : : www.vk.com/id221117171.
  • : 12.4.1989 .., : www.ok.ru+ , id : 3169813,
  • : 02.01.1979 .., : . ., : , .
  • : : www.vk.com/id220176645.
  • : : www.vk.com/id220654624.
  • : : www.ok.ru+ , id : 73485952,
  • : 09.03.1929 .., : ., . -, 4
  • : 04.01.1968 .., : 21061, 84202, , 1995 .., : 2106103483795, 3483795, 3821380, .: 39670, : , , , 9.
  • "" ( ""): .: 04.02.2013 ., : 7804163706, : 1037808016168, : 780401001, : 40273564000, : .2 .21.1 08.08.2001 129-, : 195265, - , , 9.
  • : 25.06.1958 .., : , ., .4, .2.
  • : .: 8 (921) 7439072, 2367949, 2367949, : C-, . 12
  • : 06.01.1953 .., , . . 10, . (495) 4837482.
  • : 01.02.47 .., : , , . , ., ., 3, 6
  • : 24.8.1981 .., : AleksA, : www.ok.ru+ , id : 73649351,
  • ???Vuitton: : rgolovanova@bk.ru
  • A.RAYMOND JABLONEC S.R.O - , : 46 605 JABLONEC NAD NISOU CS. ARMADY 27/4609, : " ", : 188230, , , . 1, : - 8-812-600-16-74, : . , . . - "A. RAYMOND SARL", A. RAYMOND
  • : : www.ok.ru+ , id : 27968468,
  • : : ., .78
  • Power Max: : www.ok.ru+Power Max, id : 3276364,
  • : : www.ok.ru+ , id : 3159245,
  • : 07.06.1957 .., : , . .2/16
  • ..: , . . 36 . 3 ,
  • : : , ., : , : , ., - .., : , , : , , ., : www.ok.ru+ , : , : , , ., id : 73460729, : , , ., : .
  • : 01.02.95 .., : , , ., 154, 10
  • MC AUTOMOBILE (EUROPE) N.V. - , : 1082MD AMSTERDAM VINOLY BUILDING 12 TH FLOOR CLAUDE DEBUSSYLAAN 28, : " ", : 117485, , . , . , . 30/1, . 2, : - 8(495)225-92, : / MITSUBISHI OUTLANDER 2.0, 15.06.2013 .., /5 VIN:JMBXTGF2WDZ017540 , : JMBXTGF2WDZ017540, : , :5, . :4, : ,:, .:, . :4B11, .:LQ9787, - ., MITSUBISHI
  • " " 7730579182 1087746346093: ./: 2485527, 0, : 121096, , 2-, 7/19, 6, .
  • : : , - .., : www.ok.ru+ , id : 73506186,
  • : 11.6 .., : www.vk.com/id220087835.
  • : 04.08.1956 .., : , - 5640100000, , 6, : MERCEDES-BENZ, MB 100 D, 75343, 1995 .., : VSA63133213165728.
  • : : www.ok.ru+ , id : 73809840,
  • : 15.8.1988 .., - .., .: +375444733239, : , : www.ok.ru+ , : , id : 73078509,
  • : .: 9113120451, : 184209 ., . , .42
  • : : , ,8,2
  • : 24.11.1998 .., : . . : , 48.
  • : 1927.06.16 .., : , -, , , 42, : 21013, , 73036, , 1981 ..
  • : : , : xenon_41@mail.ru
  • : 1939 .., : . , , , 252.
  • : : www.vk.com/id220908266.
  • : 5.1 .., : www.vk.com/id146829424.
  • Kim Sasha: 3.3.1993 .., : asdfasdf, : fasdfasdf, francia - .., : asdfasdfasd, : asdgasdg, : www.ok.ru+Kim Sasha, : asdfasdfasdf, : asdfasdfasdgasgasd, id : 3229644, : 123123124sef, : 123213123123.
  • Sdfas3f1268170284750ssdfsd Sdfas3f1268170284750ssdfsd: : www.ok.ru+Sdfas3f1268170284750ssdfsd Sdfas3f1268170284750ssdfsd, id : 73626153,
  • : 06.09.1984 .., : , , , 5\. : -
  • ²: : 3113615854, 31.03.1985 .., - .., : ,
  • : 16.07.1938 .., , . 83 . 2, . (495) 1402126.
  • : : www.ok.ru+ , id : 73518502,
  • : . , , , 10, 53
  • : 24.1 .., - .., : www.vk.com/id146537612.
  • : 05.06.1953 .., : 21061, 07202, , 1995 .., : 210610S3452756, 3452756, 3725544, : , , , 50.
  • : : www.ok.ru+ , id : 73736910,
  • : .: 89059007416 (), : . . 63
  • : 08.11.2004 .., : ( ), : ., .1
  • Kloet A J G: .: 318621439, : , , 6714BE, Ede gld, Valkestein, 723.
  • : 10.1.1986 .., : www.vk.com/id220671265.
  • : : 3071022273, 30.01.1984 .., ̲ - .., : , ̲
  • Xxx Xxx: 25.3.1985 .., : , : www.ok.ru+Xxx Xxx, id : 73684873,
  • : 11.06.1961 .., : , , , 44
  • : : www.ok.ru+ , id : 27825923,
  • : 1952 .., : 3 5. :
  • : : 3064921334, 30.11.1983 .., .ȯ - .., : , .ȯ
  • : 23.06.1976 .., : , , 20.
  • : .: +79513048731, : www.vk.com/id146491353.
  • : 22.05.1951 .., : , , , , , 15, : 2125101, , , 23363, 212510J0137204, 0137204, 5899571, 1988 ..
  • RUGAO City XIABAO Town MAZHUANG Primary school: : ZHANG,YONGXIU, : , 226563, Jiangsu, Nantong, MAZHUANG Village, XIABAO Town.
  • WUXIAN City Development Zone City Nan jiu JIA: : ZHOU,BAILIANG, : ese meal ., : , 215128, Jiangsu, Suzhou, BAIYUN Street, Development Zone, .: (512) 5361452.
  • : 11.10.1993 .., - .., : , : www.ok.ru+ , : ST1M , id : 73440502,
  • : 08.02.1999 .., : , . 12 . 2, .: (495) 1832772
  • : 31.05.2001 .., : , , .41, .2.
  • : : , . .24/2
  • Nakipova Aidana: : www.vk.com/id220318841.
  • : 02.07.1978 .., : , . . 2, .: (495) 2317891
  • : - .., .: 8927*******, : , : www.ok.ru+ , : , , id : 73090506, : , . ,
  • : 01.08.1959 .., : , ., . , 3
  • Ͳ ²˲ : : 3104612157, 31.12.1984 .., Ѳ - .., : , Ѳ
  • : 20.2.1993 .., - .., : www.vk.com/id220356117.
  • : 7.4 .., : www.vk.com/id146883762.
  • : 08.10.2003 .., : , .59 .4
  • : 12.08.1963 .., : , . .17
  • : 31.08.1925 .., : . -, -, ., 23, .: (812) 5282247.
  • : 19.02.1943 .., . , . .26
  • : : 1392117998, 11.02.1938 .., ײ - .., : , ײ
  • ..: , . . 95 . 3 ,
  • : : 3084921559, 17.06.1984 .., - .., : ,
  • : 08.12.1965 .., : , . .18
  • : .: 8 9025283289, : , 9 , , 63
  • : 26.9 .., - .., .: 89320986330, : www.vk.com/id220610424.
  • : 14.02.1955 .., : , , , 52
  • : 13.09.1971 .., : " " 5256079873, : , .
  • Nurnberg Thomas: 18.6.1975 .., : www.vk.com/id221000159.
  • : 19.07.1946 .., : -2109, -, 4404, XTA210930R1408449, 1422598, R1408449, 1994 .., : , , 25 38
  • : 26.9.1999 .., .: 0951635138, : www.vk.com/id220449363.
  • : 17.03.1965 .., : , , , 7.
  • : 9.8.1999 .., .: +375298359965, : www.vk.com/id220636623.
  • : 01.04.1962 .. : . :
  • : 11.09.1959 .. : . :
  • : : . . 150, : TOYOTA TOWN ACE 1994 .(01.01.1994), 1974, . VIN-.
  • : 10.08.1955 .., : ., ., , .9/1
  • ò: : 3111017538, 05.03.1985 .., .ȯ - .., : , .ȯ
  • : 25.10.1927 .., : , . . .1/3
  • : : www.vk.com/id146557620.
  • : : www.ok.ru+ , id : 73102258,
  • ..: : , 3- . . 6 . 2 ,
  • ˲ : : 3054422573, 17.08.1983 .., - .., : ,
  • : : www.vk.com/id220285229.
  • Stribos R: .: 495539178, : , , 6004TS, Weert, 's-Hertogenradestraat, 15.
  • : 15.07.1999 .., : , . .66
  • : : www.ok.ru+ , id : 3158786,
  • : 22.05.1951 ..
  • : 10.09.1951 .., : 968, 45802, , 968, 1993 .., : 968001822564, 1822564, 923811, : , , , 29.
  • : 12.9 .., .: 8988*200*38, : www.ok.ru+ , id : 73249796, : ask.fm/id73249796.
  • : 08.05.1960 .., : ., , , .11
  • : 06.10.1936 .., , . . 60, . (495) 1284652.
  • : : ., .- - 113, : 2101, 2748, 1980 .., : 4192655.
  • : , . . 19 ,
  • : : www.ok.ru+ , id : 73213294,
  • Konovalov Nikita: : www.vk.com/id220839559.
  • : 22.04.1956 .., : , . . 2 . 6, .: (495) 3161465
  • : : www.vk.com/id220971566.
  • : : www.vk.com/id220770450.
  • : 01.01.1958 .., : ., --, , 20.
  • Promo en Design Reclamestudio: .: 402851844, : , , 5667JB, Geldrop, Mierloseweg, 53/A.
  • : 22.11.1968 .., : , ., .52,
  • : : www.vk.com/id220366382.
  • : .: 1736294, : , , -. - 6 . 57
  • '': : , - 5923286201, 0, : , 53, 7863, 1980 .., : 0, 0439011.
  • : 8.6.1982 .., : www.vk.com/id221160717.
  • Fofa46 Andrij46: : www.ok.ru+Fofa46 Andrij46, id : 73857580,
  • : 30.03.1922 .., : ., . -, 17
  • Jongh M G: .: 183634738, : , , 4201ZP, Gorinchem, Rond de Watertoren, 67.
  • SATTAROV FARRUKH: : --> , : -.
  • : Bohain Picardie SAS: : Head Office, : 1927 ., : FR 02110 34, Rue Paulin Pecqueux BOHAIN EN VERMANDOIS, 34, Rue Paulin Pecqueux FR 02110 BOHAIN EN VERMANDOIS France, : Odette Mercier - Chairman, : 33323058521, bohainpicardie@tissali.fr, : Manufacturers, Services : 70 : 100000 (EUR) : SG.
  • : .: +79054709392, +78877525170, : , 385060, , . . , . , 5
  • : .: 8 9502890840, : , a, a, 45
  • : 21.01.1959 .., : , , .. 46
  • Wijnhof-vd Meer A: .: 182519559, : , , 2805VV, Gouda, Reinaertplein, 28.
  • : 31.1.1989 .., : www.vk.com/id146537645.
  • : 16.9.1999 .., - .., .: 0957961315, : www.vk.com/id220298751.
  • : 10.11.1926 .., : , .
  • : : ............./??/)..............(\?`\.. .... ......, : .s 1.6, warhamer 40000, , .S SOURCE Warhammer 40.000-Dawn of War II, PERFECT WORLD, 2, WoW, , - .., : , : 1, 2, 3, 4, , : www.ok.ru+ , : , , , , , : Rammstein, eminem, , id : 27733213, : , , perfect world), : .
  • : 18.07.1953 .., : , 24
  • : 31.12.1982 .., : , . .70 .1
  • ˲ : : 3160815976, 16.07.1986 .., - .., : ,
  • : 15041960 .., : ., .179 .2, : 21070, 50564, 1997 .., : XTA210700V1063840.
  • : 17.11.1979 .., : ., ., , 29
  • : 11.6.1999 .., - .., .: +79200530405, : www.vk.com/id146826308.
  • Kosta Nika: 7.4.1994 .., : KoStaNika, .: nokia, : www.ok.ru+Kosta Nika, id : 73538541, : .
  • Nurkasimov Sultan: : www.vk.com/id220381307.
  • : - .., : www.vk.com/id220665639.
  • : 03.05.1930 .., : , 432, ., ., 2
  • : 23.6.1986 .., - .., : www.ok.ru+ , id : 3100081,
  • : 27.07.1975 .., : . -, -, ., 3, .: (812) 5838106.
  • : 18.10 .., - .., .: , : , : www.vk.com/id220181804.
  • : 29.09.1987 .., : . - 4
  • : 1955 .., : , , (2), 11.
  • : : www.vk.com/id220059017.
  • : .: 89267766835 - 2005 . . , . , , .: ,, , , .: ,,,. , .:4 , , , ,-, , . , , mp3,USB + (10 ). . . - . (, Volkswagen Golf, 2000, , Volkswagen Golf, 2000 . 170 000 - 179 999 , 1.6 , , , , : 248000 .), : , .
  • : : www.vk.com/id220769169.
  • : .: 79191695624, 74746796212, : 399746, , -, ,
  • ALISHEROV RAKHMONALI: : --> , : - .
  • Sonic Wiew: : www.ok.ru+Sonic Wiew, id : 73583074,
  • : : , . .18 .1
  • - ͳ: : www.vk.com/id220868337.
  • : 17.01.1983 .., , 5- . 10, . (495) 3552889.
  • ..: : , , 102, .: 8 (3537) 39428.
  • : 5.12 .., : www.vk.com/id146625783.
  • : 18.11.1977 .., - .., : www.vk.com/id146815585.
  • Mamdouh Menna: 18.11.1992 .., : www.vk.com/id220655799.
  • : 19.12.1949 .., , . . . 22 . 3, . (495) 1616557.
  • : 19.8.1985 .., : - , ..., - .., : . ., .: )))), : www.ok.ru+ , id : 73260119, : , , ,
  • : 21.03.1978 .., : , , . .20
  • : 21.04.1921 .., : . -, -, ., 15, .: (812) 1444751.
  • : 15.07.1966 .., : ., . -, 21
  • : : , -: , . , 17, .: 8 (4822) 558971.
  • : 8.12.1985 .., : www.ok.ru+ , id : 73260935,
  • Dassa Das: : www.ok.ru+Dassa Das, id : 73858236,
  • : 01.03.1981 .., : ., , . , , .5
  • Vovan Vovan: : www.ok.ru+Vovan Vovan, id : 73767197,
  • Beimbetova Saniya: : www.vk.com/id220064323.
  • : 11.05.1951 .., , . . 11 . 2, . (495) 1257757.
  • : 18.06.1938 .., : , -
  • : 17.10.1976 .., : , .
  • : 7.2.1990 .., : www.ok.ru+ , id : 3237963,
  • : : www.vk.com/id220115294.
  • : 13.08.1928 .., : ., . -, 27
  • ³: : www.ok.ru+ ³, id : 73874956,
  • : : www.vk.com/id146893604.
  • "" - "": ,
  • : .: 8 (921) 6347732, 4445744
  • : 24.12.1988 .., - - .., .: 89674490919, : www.vk.com/id220901397.
  • Ol Pet: : www.vk.com/id220596077.
  • ..: : , . . 18 ,
  • Mihaleva Oksana: 12.5 .., : www.ok.ru+Mihaleva Oksana, id : 3165827,
  • : 16.01.1979 .., : ., --, , 44.
  • : : , . . 13/1, . (495) 2751317.
  • : 17.8 .., - .., : www.vk.com/id220684331.
  • : 22.06.1962 .., : , . .3 .1
  • : 11.09.1993 .., , . . 43 . 2 0, . (495) 4548622.
  • : ., .: 8 (3452) 250074.
  • Kh Zhanik: : www.vk.com/id220526208.
  • : 03.03.1972 .., . , . .40
  • : 19.04.1947 .., : . -, -, ., 6, .: (812) 1100293.
  • @: : www.ok.ru+ @, id : 73596324, : ....
  • Kirillin Tolya: - .., : , , : www.ok.ru+Kirillin Tolya, id : 73120919, : , , , ,
  • : 29.08.1954 - .., : , , , , , 16, : 21013, , H344DVM, 64700294, 1985 ..
  • : : www.vk.com/id220264837.
  • : .: +7 (495) 790-02-09, : , . 2- , 6/8, @-www: info@mactailor.ru, www.mactailor.ru, : , , , , , ,
  • : .: , : www.ok.ru+ , id : 73685167, : .
  • : : www.vk.com/id221139674.
  • : : www.ok.ru+ , id : 73296643,
  • : 01.11.1964 .., : , , .( -).
  • : : , . . 11 . 2, . (495) 1809198.
  • : 21.10.1977 .., : , , -.
  • : : www.vk.com/id221202399.
  • : : 3157015791, 08.06.1986 .., ̲ - .., : , ̲
  • : : , .14
  • : 07111976 .., : ., - .9, : 21150, 57664, 2004 .., : XTA21150053838703.
  • : 15111919 .., - .., : - . . .41.
  • : : www.ok.ru+ , id : 73318793,
  • : 22.02.1960 .., : , . .19
  • 03.11.1926 ..: : ., . 5 . .7
  • : 17.02.1968 .., : , , ().
  • : 23.09.1954 .., : 1036, 2466, , 1982 .., : 197462, : , , 30.
  • : 27.05.1946 .., : . 10
  • : : www.vk.com/id220958704.
  • : .: 89144325223 (), : . (.), , , 10
  • Petrov Aleks: : www.ok.ru+Petrov Aleks, id : 3190860,
  • : : judo-_-___---sport$$&,#, : www.ok.ru+ , id : 27979110,
  • : 01.01.1925 .., : ., , , 10.
  • в : : 3174410332, 29.11.1986 .., - .., : ,
  • : 25.04.1978 .., : , .13 .1
  • Lover Hentai: 8.5.1992 .., : www.vk.com/id220722239.
  • ..: .: 8 (3812) 227784, : , 30.
  • : 16.11.1992 .., : www.vk.com/id220303569.
  • : 23.12.1943 .., : 443084, , ., : 2101, , , 1372 *, 1371747, 1500754, 1975 ..
  • ˪ в: : 587301474, 30.01.1916 .., - .., : , Ͳ
  • : 25.05.1969 .., : .:; .
  • : : www.vk.com/id220670548.
  • : 14.12.1992 .., . - .., .: 89110893154, : www.vk.com/id221003387.
  • : 21.09.1960 - .., : , , , , 9-, 62, : 2715, , H967DKM, 0185073, 1985 ..
  • : . , . .9
  • : 06.09.1948 .., : 21043, 62702, , 1995 .., : 0484960, 3591841, : , , , 11.
  • : 11.10.1962 .., : , , , 88
  • : .: 8 9241332202, : , ; , 8
  • : 1921 .., . - ..
  • ******* : : www.vk.com/id146651699.
  • : 21.5 .., : www.ok.ru+ , id : 27747366,
  • : 26.4 .., : www.ok.ru+ , id : 73816382,
  • : : , . 16,.1
  • Mohamed Jaldy: 1.5.1983 .., : www.vk.com/id220388728.
  • : - .., : ), : www.vk.com/id220024738.
  • " " ( ): .: 08.10.2012 ., : 6103004618, : 1026100016821, : 610301001, : 60205805001, : .2 .21.1 08.08.2001 129-, : 346610, , -, -, , 11.
  • : 7.4.1980 .., - .., : www.ok.ru+ , id : 3214097,
  • : 25.09.1949 .., : 650024, . , ., . .11
  • : 8.1 .., : www.ok.ru+ , id : 3284944,
  • : - .., : www.vk.com/id220275756.
  • : : www.vk.com/id220331164.
  • : 01.09.1954 .., : , .
  • 15.11.1977 ..: : ., .80
  • : .: +79046987455, +74742724656, : 398000, , ,
  • : 15.06.1915 .., : , . .164 .1
  • : .: 89168213096 - . 7- 12- , 46/, 16,6/ 13,7/, 6,6/, . , . : -, , , , , , , , . : , , . ( ). : : , - . . : 38/. + + 40/. ( , ). : , , . 12:00 24:00 (, 2- , 46 .., 7/12 ., , 2- 46 .. 7 12- , : 38000 .), : , . , .
  • : 15.05.1929 .., : , 3- . .11
  • : : www.vk.com/id146827111.
  • : : ., . -, 27
  • : 17.10.1914 .., : , . .12
  • : .: 0999282977, : www.vk.com/id220085799.
  • : : www.vk.com/id220982829.
  • ˲ : : 2567522559, 18.04.1970 .., .ȯ - .., : , .ȯ
  • : 9.12.1987 .., .: +9110260914, : www.ok.ru+ , id : 3220980,
  • : - : : , : 2003 ., : ., 52-, ., , 625026, ., 52-, ., , 625026, : - ., : 73452208350, rgs67@rgs.ru, rgs-tyumen.ru, : ,, ..
  • : : www.ok.ru+ , id : 27980158,
  • : 6.7.1988 .., : , : www.vk.com/id146717444.
  • Totsunagi Kirito: 9.8 .., Tokyo - .., : www.vk.com/id220932253. : . , ., , / "", . 4.
  • : 20.08.1944 .., : , , .
  • : TOYOTA VISTA, (), , , , 85425, 1988 .., : , :
  • : 30.10.1998 .., -- - .., .: 89518439417, : elizabeth.kravchenko, : www.ok.ru+ , id : 73839123,
  • : 15101982 .., - .., : - . . .12.
  • : : www.vk.com/id220657186.
  • : 9.9.1990 .., : ??, .: +795344583**, : www.ok.ru+ , id : 73089728, : .
  • Bahtybaev Aibek: 27.3.1984 .., - .., : www.ok.ru+Bahtybaev Aibek, id : 73567747,
  • : 20.08.1973 .., . - ..
  • : 05.06.1961 .., . (495) 2567373.
  • : TOYOTA ESTIMA LUCIDA, (), , , , 41225, 1993 .., : ,
  • : 1.11.1981 .., : www.ok.ru+ , id : 27988061,
  • Alonso Mouad: 16.7.1995 .., : www.vk.com/id220302632.
  • : 01.02.39 .., : , , -., ., ., 3
  • : 28.10.1986 .., : , . . .22 .2
  • : 25.10.1912 .., : , . .10 .2
  • : 14.4.1999 .., . ϳ () () - .., .: 380*******46, : , : www.vk.com/id220313495.
  • : : www.vk.com/id146910404.
  • : : ""
  • : 11.08.1959 .., : , 43402, , 1975 .., : 16786, 280733, 38764, : , , , 2.
  • : 17.11.1954 .., : , , 18 3
  • : 22.04.1966 .., : . -, -, ., 23, .: (812) 5833565.
  • : 26.01.1976 .., : , , ,
  • : 18.03.1986 .., : , , , 10
  • EMEX DWC-LLC - , : 16826 DUBAI P.O. BOX, : "", : 140091, , ., . , .22 .1, : - +7(965)145-4, : . , 12, 55 : : 1869108041 - 3 ; : 9436926020 - 2 ; , . 176-5707-8744, . - TOZAI TSUSHO CO. LTD, EMEX
  • : 3.7.1964 .., : www.ok.ru+ , id : 27704852,
  • : : www.ok.ru+ , id : 73504437,
  • : 29.04.1949 .., : , .5 .1
  • : : 772702633, 26.02.1921 .., - .., : , Ͳ
  • SEVOSTYANOV EVGENY: : - --> , : Sky Express.
  • : . .: 8 9038261905, : . . 24
  • : : www.ok.ru+ , id : 73516458,
  • : 28.11.1953 .., . , . .37
  • : .: 89144661135 (), : . (.), . 13
  • : 14.12.1980 .., - .., : www.ok.ru+ , id : 3086398,
  • - : : www.ok.ru+- , id : 73198226,
  • : : www.ok.ru+ , id : 28059950,
  • : 08.01.1932 .., : , . .18 .1
  • : : www.vk.com/id220113621.
  • : : www.vk.com/id220258279.
  • в : : 3110316472, 26.02.1985 .., - .., : ,
  • 1518186@rambler.ru 1518186@rambler.ru: : www.ok.ru+1518186@rambler.ru 1518186@rambler.ru, id : 73330057,
  • : 22.01.52 .., : , , 59.
  • ³ : 17.07.1948 .., : 95053, , , .ѳ, ., 32.
  • : 13.04.1988 .., : ., , , .38
  • : 17.7.1985 .., - .., : www.ok.ru+ , id : 3290025,
  • : 15.5.1985 .., : www.ok.ru+ , id : 3192235,
  • : 10.2.1990 .., .: 89052.16.., : www.vk.com/id221083780.
  • : 22.02.1993 .., : , - , .
  • : 15.02.1955 .., : , , .
  • : 4.8.1984 .., - .., : www.vk.com/id220081301.
  • : : 3119118115, 25.05.1985 .., в - .., : , в
  • : 08.12.1997 .., : , ., 76
  • : 22.04.1928 .., . , . .18 .2
  • : 11.07.1957 .., : , . .67 .4
  • : 15.10.1941 .., : , . . 24 . 2, .: (495) 1847798
  • : 02.10.1975 .., : ., --, , 108.
  • : 19.05.1940 .., : , - , , 2.
  • Ͳ: : 3119816497, 01.06.1985 .., ί - .., : , ί
  • Zakharevich Inessa: : www.ok.ru+Zakharevich Inessa, id : 27938758,
  • : 02.02.1942 .., : , .114 .3
  • : : www.ok.ru+ , id : 73575505,
  • Ru Ru: : www.ok.ru+Ru Ru, id : 73676644,
  • : : www.ok.ru+ , id : 3285209,
  • : 12.02.1925 .., : , . .7 .2
  • : : www.vk.com/id220413633.
  • : 03.04.1985 .., , . . 45 . . 45, . (495) 9484038.
  • : 16.01.1964 .., : - , .
  • Guisado-Iglesias Jesus: 26.1.1983 .., : www.vk.com/id220232737.
  • : : ., 163030, , , 7, .: 8 (8182) 628086.
  • : 11.05.1968 .., : .., : , .
  • : 06.01.1948 .., : , . 5
  • : 20.01.1956 .., : ., .- - 37, : 4502, 62178, 1985 .., : 130 167969.
  • : 04.07.1990 .., : , .
  • Volia Pasha: Petushakni - .., : www.ok.ru+Volia Pasha, id : 73500185,
  • : 08041984 .., : ., .1, : 21074, 25564, 2005 .., : XTA21074052226774.
  • : - .., : zhenka.55, : www.vk.com/id146478862.
  • : .: +7 (495) 856-91-00, : , ., ., 1, @-www: shopselena@yandex.ru, www.myselena.ru, : , , , -, ,
  • : : www.ok.ru+ , id : 73421030,
  • 23.07.1984 ..: : ., .
  • : 24.11.1913 .., : , . . 20, .: (495) 1656282
  • 07.10.1998 ..: : ., . . .2
  • : : www.ok.ru+ , id : 3117573,
  • : 08.03.1928 .., : , .50 .3
  • : 17.04.49 .., : , , 25.
  • : 21.04.1957 .., : , . . 21, .: (495) 9784482
  • ̲ : : 2165224411, 13.04.1959 .., - .., : , в
  • : 25.02.1956 .., . - .., .: (), 1900 .., . - ..
  • : 01.01.1959 .., : ., . -, 5
  • 16.05.1966 ..: : ., . .39
  • : 03.09.2001 .., : , - ., , 73
  • : . .: 8 9056445179, : 396420 . . 36
  • : 17.3.1988 .., : , : www.ok.ru+ , id : 27827740, : -------------.
  • : .: +79196696575, +78354026035, : 429521, , -, -,
  • : .: 8 (921) 9941704, 2257342
  • : 28.09.1982 .., : , , , 112/2
  • в : : 3013922918, 08.07.1982 .., ² - .., : , ²
  • : 5.9.1986 .., - .., : www.vk.com/id220139124.
  • : : , . . 5 ,
  • : : : ., 30, ., ., , 612410, ., 30, ., ., , 612410, : - , : 78333724300, : . . ., , , , , .
  • : 31.8 .., : www.ok.ru+ , id : 28048797,
  • : 10.03.1970 .., : , 2-, 2, .: 8 (3812) 47, : 8.103-10, 2146, 92_ ..
  • : : www.ok.ru+ , id : 3164694,
  • : 07.05.1955 .., : . .2
  • : 01.01.1936 .., : ., , , 186.
  • : : www.vk.com/id220589096.
  • Andrianova Svetlana: : www.ok.ru+Andrianova Svetlana, id : 73360749,
  • : 1974 .., : . , , , 187.
  • Love west school Yatomi high school: : , 498-0048, Tokai/Aichi/Yatomi, www: yatomi-h.ed.jp/, yatomi-h.ed.jp/, yatomi-h@ask-net.jp, : Education/
  • Rudyh Polina: 19.8 .., : , , - .., : , : , : www.ok.ru+Rudyh Polina, : , : , , id : 73424692,
  • : - "". : , 10/2 4. : 3-74-78 52-05-33, 3-74-78 52-05-33. : 834900 .
  • : : www.vk.com/id146806082.
  • : 28.04.1978 .., . , .92 .2
  • : òʲ Ͳ ʲֲ ( òʲ ʲֲ), : , 83022 , , . , .8, .: , 83022 , , . , .8, .: , 272, 26.06.1991 ., : 1) 2658005, . ϲ ֲ.òί ., . 999999, : : 98300 ϲ : 91.20.0 ii i i, ..: 769593 ..: 769593.
  • : 15.04.1974 .., : ,
  • : 15.09.1966 .., : , .
  • : 31.12.1997 .., : , , .
  • : 05.01.1963 .., . , . .2 .2
  • : : www.ok.ru+ , id : 73313296,
  • : 07.01.1947 .., : , 424, , ., 44-
  • Cojocaru Vasile: : www.ok.ru+Cojocaru Vasile, id : 73844385,
  • : : . .: 277950.
  • Deborha Bloemenkiosk: : -, 3015LA, Rotterdam, Eendrachtsplein, 1, .: 102130591.
  • : : www.vk.com/id220010588.
  • Martirosyan Lusine: 13.7.1995 .., : www.vk.com/id220139541.
  • : , . . 18 ,
  • : 10.7.1972 .., : danilka200420139, : www.vk.com/id220763331.
  • : 11.10.1986 .., : www.vk.com/id146865477.
  • : 23.8 .., .: 79511605205, : www.vk.com/id220069688.
  • Slavik Slavik: .: 00351963825506, : www.ok.ru+Slavik Slavik, id : 73274102,
  • : 5.11.1991 .., : <,~Saske`Uchiha~>,, .: 8967*******, : www.vk.com/id146893385.
  • : : www.ok.ru+ , id : 73455277,
  • ² ֲ '': : , - 5940200000, 0, : , 3976, 2448, 1993 .., : 0013346, 1458821.
  • : 18.10.1974 .., : (), . , 31
  • Lockyer Sandra: : www.vk.com/id220472667.
  • WUXI City SHANBEI Technology Cosulting Service dept.: : ZHOU,MIN, : , 214037, Jiangsu, Wuxi, Government, SHANBEI Town, .: (510) 3706324.
  • : 17.07.1985 .., : ., , , .85
  • : : www.ok.ru+ , id : 73531015,
  • 9600649473 PRE_PAY: ..: 8 9600649473
  • : : www.vk.com/id220684698.
  • : 28.08.1955 .., : , .
  • : 20.07.1999 .., :
  • : : , 20/1
  • : 10.10.1978 .., : , . . 18, .: (495) 3577210
  • : 09.11.1976 .., : ., , . , , .5
  • : 29.11.1955 .., : , , ., 3. : " ", : ., ., .2
  • : 01.05.1931 .., : 7.
  • : 23.07.1950 .., : ., . -, 5
  • : 02.12.1965 .., : , , , 44.
  • Ҹ: : www.vk.com/id220332050.
  • : : www.vk.com/id220040500.
  • : , . . 38 ,
  • , , : 968, 607423, 0418, 1983 ..
  • : .: 9211745940, 72555, : , , 3; : , , ,
  • : 20.08.1955 .., : , , .(- -).
  • : : www.vk.com/id220438051.
  • 21.12.1968 ..: : ., . .84
  • 14.01.1992 ..: : ., . .29
  • XISHAN City WEISHIJIE Materials Co.,ltd.: : WU,ZHONGWEI, : coal carbon steels textile, : , 214007, Jiangsu, Wuxi, Room 508, WUZI Building, No.7, RENMIN DONG Road, .: 13601518412.
  • : 19.02.1957 .., H H H -H - .., : (.: 17.08.95 H) 17, .
  • : : www.vk.com/id221021039.
  • : : www.vk.com/id220624451.
  • 9053728895 PRE_PAY: ..: 8 9053728895
  • : : ., . -, 19
  • : 08.08.1958 .., : , ., . , 2
  • : : www.vk.com/id220057364.
  • Zzzzlfgjghhgh Zzjdhjgfhjdf: : www.ok.ru+Zzzzlfgjghhgh Zzjdhjgfhjdf, id : 73878401,
  • : 19.3.1988 .., : www.ok.ru+ , id : 3271219, : .
  • : 13.7.1971 .., - - .., : www.vk.com/id146821457.
  • : 08.08.1965 .., : 653033, , -, , ., . 2
  • : : , . . 3, . (495) 1427597.
  • : 13.2 .., - .., .: 89642757511, : www.vk.com/id146871541.
  • : 03.06.1978 .., : , . .31 .1
  • : 13.4.1976 .., : www.vk.com/id220877840.
  • : 2.5 .., : www.vk.com/id220578584.
  • : 28.01.1937 .., : , . .21 .2
  • : : www.vk.com/id146877629.
  • Ͳ : : 3128116594, 23.08.1985 .., в - .., : , в
  • : 29.01.1991 .., : ,
  • : 1951 .., : 45/. :
  • : 07.05.1956 .., : 1111, 13102, , 1994 .., : 111100R020875, 020875, 0041642, : , , , 118.
  • : 05.10.1982 .., :
  • : 01.01.1900 .., : , - 5925087201, ., ., : , 968, 2322, 1990 .., : 1553520, 1597181.
  • : 17.02.1942 .., : , , ., -, ., ., 11, : 21213, -, 59463 *, 21213011542212, 1542212, 6032542, 2000 ..
  • : 20.02.1910 .., . , . .5 .2
  • : : - , , , .10,
  • : : www.ok.ru+ , id : 73100312,
  • Lammers C: .: 206449601, : , , 1082PA, Amsterdam, Krooswijkhof, 60.
  • : 01.07.1947 .., : , 4- . 11
  • : 06.04.1955 .., : . -, -, ., 2, .: (812) 3485918.
  • : : www.ok.ru+ , id : 73693011,
  • 9609144976 PRE_PAY: .: 89609144976 ()
  • : 02.01.1966 .., : 214122, 65902, , 1996 .., : 2141220581506, 0581506, 643440, 0073671, : , , , 14.
  • : : www.ok.ru+ , id : 3248055,
  • 20.01.1984 ..: : ., . .27 4
  • : - .., : www.vk.com/id220951089.
  • : : www.vk.com/id220819777.
  • : 27.10.1964 .., : , , , 81
  • : 040253 .., : ., .1, : 21011, 65964, 1979 .., : XTA21011092989824.
  • : 26.02.1979 .., : ., , , .83
  • : .: 9095601354, : 184250 , . , . , .6
  • : 30.06.1978 .., : , . . 8
  • : 03.11.1941 .., : , - .., , 2. : 26 ..
  • : 03.01.1953 .., : ., ., ., .5
  • : 1.4.1992 .., : www.ok.ru+ , id : 28060079, : (:(:(:(:(:(:(:(:.
  • Mirt Olga: 13.8 .., : www.ok.ru+Mirt Olga, id : 28059460,
  • : 12.04.1986 .., . , . .13 .3
  • Olia Love: : www.ok.ru+Olia Love, id : 73200416,
  • : 12.08.1991 .., . , .
  • : 07.08.1965 .., : ., --, , 266/2.
  • : : , . . . 22 . 3 ,
  • "": .. .., : 5032, , 246152, XVL482302A0003105, 2010 .., : , . 3
  • Amraev Danik: : www.vk.com/id220213575.
  • : 10.09.1935 .., : ., --, -, 246.
  • Rge Gfrgergerg: : www.ok.ru+Rge Gfrgergerg, id : 73573533,
  • : 12.06.1969 .., : , . .65 .2
  • Ѳ : : 1016708418, 02.11.1927 .., ʲֲ - .., : ,
  • Gaspar Perez Jair Gadiel: 27.4.1997 .., : www.vk.com/id220896808.
  • : 10.04.1938 .., : 81061, 383902, , 1988 .., : 030173, : , , 30 , 19.
  • : 24.6.1988 .., - .., .: , : www.vk.com/id220323455.
  • : : www.vk.com/id220691224.
  • : .: 8 (921) 6500264, 3295661, 3295661
  • : 28.12 .., : www.ok.ru+ , id : 73707384,
  • : 08.11.1927 .., : ., , , .3
  • Erh Hetrh: : www.ok.ru+Erh Hetrh, id : 73578180,
  • : : www.vk.com/id220215346.
  • : : www.vk.com/id220430166.
  • : 27.08.1950 .., : , . .35/58
  • : 03.06.1980 .., : , , .
  • Yangzhou XINXIN Leatheware Co.,ltd.: : XU,YUMING, : leathergarments manufactory marketing, : , 225107, Jiangsu, Yangzhou, South Suburb XINBA Town, .: (514) 7411563.
  • : : www.ok.ru+ , id : 27940968,
  • : 01.03.1933 .., : ., , .
  • : : www.ok.ru+ , id : 27909459,
  • Er We: : www.vk.com/id220023526.
  • : 13.04.1962 .., : 446200, , , , , , 17, : 21100, , --, 59563 *, 2110000234106, 0234106, 0171159, 2000 ..
  • : .: 8 9145756055 - , : ., 675000 . 266
  • : 23.2.1998 .., @@@ - .., .: )))))))))))))), : ?, : www.vk.com/id146509361.
  • : 23.08.1982 .., : , . .4 .2
  • : : www.ok.ru+ , id : 73388072,
  • : : www.ok.ru+ , id : 73254215,
  • ²˲: 06.04.1971 .., : , - 5920650100, ˲Ͳ, 30, : , 2109, 0331, 1987 .., : 0.
  • : 2.7 .., : www.vk.com/id220414152.
  • : 18.01.1980 .., : . -, -, ., 14, .: (812) 5312732.
  • : 8.7 .., - .., .: 89670425843, : sevdiyor_1998, : www.vk.com/id220482210.
  • Kurbanov Muslim: 7.11.1990 .., : www.vk.com/id220762734.
  • "" ("" (3)1677): .: 03.03.2007 ., : 7707125529, : 1077746870695, : 770701010, : 45286585000, : .2 .21.1 08.08.2001 129-, : 101000, , , 27.
  • ˲: : 2847519711, 17.12.1977 .., - .., : ,
  • : 7.3 .., : www.vk.com/id220798220.
  • : 03.06.1955 .., . - - .., .: ()
  • : .: 89874922730, : www.vk.com/id220310823.
  • : 31.03.1991 .., : , , , 107
  • ʲ : : 3087624958, 14.07.1984 .., Ͳ - .., : , Ͳ
  • : 22.09.1997 .., : , , , 9. : 30 (), : ., , 73.
  • : 13.7.1971 .., : www.vk.com/id220460244.
  • : : www.vk.com/id221176886.
  • : - .., : www.vk.com/id220208060.
  • : .: 8 9051134555, : . . . 32
  • : : www.vk.com/id146751274.
  • Ѳ : : 3087626231, 14.07.1984 .., в - .., : , в
  • : : www.vk.com/id220507349.
  • ò ²: : 3098317111, 29.10.1984 .., - .., : ,
  • : : www.vk.com/id221098777.
  • : 19.11.1982 .., : , , . 73
  • : . .: 8 9609326301, : 650903 . . 4
  • : : 3069922533, 19.01.1984 .., ί - .., : , ί
  • Raptanova Marina: : www.ok.ru+Raptanova Marina, id : 73285156,
  • "" - "": , .: 17.01.2003 ., : 840000 ., ./: 348-36-75 329-0714, 348-36-75 329-0714, : - , : 0, : 50861368, : , : 197348, 197348, 348-36-75 329-0714.
  • : : www.vk.com/id220970740.
  • : 01.07.1912 .., : , . .42
  • : 11.09.1972 .., : --, . 36
  • : 12.7.1985 .., : www.ok.ru+ , id : 3203899, : http://vkontakte.ru/app249481_3203899.
  • Dane John: : www.ok.ru+Dane John, id : 3295507,
  • : .: 8 9084587244, : , 1- , , 42
  • : : www.ok.ru+ , id : 73335627,
  • : 8.2.1989 .., : www.vk.com/id221088573.
  • : 19.12.1980 .., : , . .18 ..
  • : 01.01.1961 .., : .,
  • Wany Book: : www.vk.com/id220868747.
  • : 20.7.1975 .., : www.vk.com/id220593165.
  • : 24.4 .., : , - .., : , : , : www.ok.ru+ , : , : ....., id : 73779996, : ..,
  • : 04.05.1961 .., . , 2- . .4 .1
  • : 15.9.1996 .., - .., .: 87771041779, : www.vk.com/id220649080.
  • - 18051975: .: 1150172, : , , -. 5, .108
  • : 01.01.1936 .., : , , , 46
  • : , . . 33, . (495) 3497966.
  • ˲ : : 2378720073, 15.02.1965 .., - .., : ,
  • : : www.vk.com/id220412121.
  • : 01.01.1962 .., . , . .4
  • : 14.03.1935 .., . - - ..
  • : : , . .22
  • : 28.03.1981 .., : ., --, , 71.
  • : : , 4399, , 1992 .., : 286129, : , ., , 6.
  • Dsff Sdfs: : www.ok.ru+Dsff Sdfs, id : 73464577,
  • : : www.vk.com/id220898386.
  • : 16.10.1981 .., - .., : www.vk.com/id220067481.
  • : 10.4.1999 .., - .., .: , : www.vk.com/id220451689.
  • : - .., .: 8903*****37, : www.vk.com/id220927772.
  • Testerrrr Testerrrr: : www.ok.ru+Testerrrr Testerrrr, id : 73164314,
  • Niot Alisa: 19.2.1993 .., : www.ok.ru+Niot Alisa, id : 73286463,
  • : 11.01.1958 .., : 97345, , , ʳ -, . , ., 117.
  • : 22.02.1937 .., : , . .19 .1
  • Haydarov Muhammad: 20.11.1994 .., : www.vk.com/id220493151.
  • : 01.01.1925 .., : , .
  • : 15.10.1966 .., : 21099, 40902, , 1995 .., : XTA210990S1677129, 1677129, 1699966, : , , , 3.
  • : 03.08.1945 .., . , . .21 .1
  • : : www.ok.ru+ , id : 73374775,
  • Soloniy Sergey: : www.ok.ru+Soloniy Sergey, id : 73187906,
  • : , 1 .9 . : : , : 07.05.1992, : 2, :
  • : 22.07.1951 .., : ., , ., .11
  • : 1962 .., : ., , , -
  • : 15.05.1930 .., : 2121, 37502, -, 1993 .., : 212100R1051480, 1051480, 3147417, .: 32065, : , , , 4.
  • : - "". : 927-12-23. : 50000 .
  • : : 3237310858, 19.08.1988 .., - .., : ,
  • : 13.12.1974 .., : ., , , .13
  • : 18.06.1975 .., , . 14 . 3, . (495) 4152231.
  • ? : : www.ok.ru+? , id : 73515143,
  • : 16.08.1961 .., : . -, -, ., 6, .: (812) 2352443.
  • : - .., : ), : www.ok.ru+ , id : 73822293,
  • : : www.vk.com/id220166777.
  • : 01.06.02 .., : , , . , ., 81, 6
  • : 15.11.1971 .., : .. : , 85.
  • : : , . .8 .1.
  • : : www.vk.com/id220345188.
  • : 25.11.1948 .., , . 84, . (495) 3900531.
  • Lenna Lenna: : www.ok.ru+Lenna Lenna, id : 73478480,
  • : 13.01.1954 .., : , . . 6 . 3, .: (495) 3944084
  • : 18.03.1985 .., : , .44 .1
  • : 24.10 .., : www.vk.com/id221104251.
  • : : www.vk.com/id220982786.
  • " "" ( " ""): .: 29.03.2008 ., : 1047796961992, : 45277553000, : .2 .21.1 08.08.2001 129-, : 125319, , , 4.
  • : : , , 25.10.1945 .. .26
  • : 12.11.1943 .., : , .
  • : : www.vk.com/id146831573.
  • : 5.10.1992 .., : , - .., .: 05082*****, : , : www.ok.ru+ , : , : , id : 73869696,
  • : 4.5.1983 .., : Fly, - .., : , : www.ok.ru+ , id : 3193791,
  • : ., .: 8 (3452) 744992.
  • ? : - .., .: 89205181916, : www.ok.ru+? , id : 73494991,
  • () : : ., ,11-33.
  • : 07.01.1968 .., : "", : ., .110
  • Kino Erika: 17.4.1991 .., Japan - .., : www.vk.com/id220014448.
  • : : , -- i - .., : www.ok.ru+ , : ---, id : 27966011, : -----.
  • : 20.05.1971 .., : , , .( -).
  • : 09.02.1988 .., : , . .1006
  • : 6.4.1998 .., : www.vk.com/id220080128.
  • : .: 8-921-8389955 (),